Clone BO04852 Report

Search the DGRC for BO04852

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:48
Well:52
Vector:pDNR-Dual
Associated Gene/Transcriptmael-RA
Protein status:BO04852.pep: validated full length
Sequenced Size:1411

Clone Sequence Records

BO04852.3prime Sequence

954 bp (887 high quality bases) assembled on 2005-12-02

> BO04852.3prime
ATGGTCTAGAAAGCTTGCTTTTTTAAGTTTCCCATCAGCGCCGTTTACGG
AGAAGTCGTTGTCTGAAACCTTCCGAATTAAACGCGAGTGCGTCGGTAAG
TTCCTAGCGTTCCATTCCCGCTGAGCACTAGCGGCGATACCGTGATGCTT
ACTAGAATTACGCATGCCGAGGCTGGGGAATTCAGAAACTTCGTTTAAAT
TTGCGGCAAAGGAAGTGTGGTCTATGGGCTTGTAGGAGCTTGATGCGACG
GAAAGTCGACTGCTAGAAAGCGAACAAGCTTCGGGTTGGCTTTCCTTCTT
GACCCCAGATCCGGGAAGCGAATAAAAAGAGTCGAAGGAGGACTCGTGGT
CGAGTGAGGAGGCGTACGAGCTTATGATAAGGTAGTTGGGTTTTGTTTGG
GCAGGTATGTGCTTTCCGGGTTGGACGGTTATGGCCAGGTCTCCGCACAT
AAAATCAGTGAAGGTATACGCCCATCTAGTCACCATACTCTGGGTACAGT
ACTTGGTTCGATCATTATCCTCGTGGTACTGACACGCAATCCCTGCGGTA
AACTCGAAAAAGTCTTTCTTAAAAAAAGCATCCGTCGCGAATTTGTTGAT
TTTCTCGTCATTCAAATCAGCGACATTCATGACCTCCTTCTTCAATATGA
ATAGCAAGTACTGGATATCAAACACCTGGATTTTTTCGCCCCCGTCCCTG
AAGTCATCATCGCACTCCAAATAGCGGAAGCATGACTTCACCATGGTAAT
ATTTTCGGCGGGTGTAAAGACTACTAGGGTCTTGCCTTTTCCCTGGCATT
TGGATAAGTAGTCAACAATGTTGCGGTACAGCTTGGTCATGTTCTTCTCC
CCCAGCGCGTTGGGCGGCAGCGGCAGGTCGTGAGTGGTTGAAGAGTGAAG
CAGGGCATCGCTACCTTGCCCAAAATGATCTGACCGGGGTCAATCATGGT
GCTG

BO04852.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG11254-PA 1380 mael-RA 471..1377 925..19 4535 100 Minus
CG11254-PC 1389 mael-RC 480..1386 925..19 4535 100 Minus
CG11254-PB 1380 mael-RB 471..1377 925..19 4535 100 Minus
CG11254-PA 1380 mael-RA 441..473 954..922 165 100 Minus
CG11254-PC 1389 mael-RC 450..482 954..922 165 100 Minus
CG11254-PB 1380 mael-RB 441..473 954..922 165 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 19:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
mael-RD 2143 CG11254-RD 1087..2023 954..19 4660 99.9 Minus
mael-RB 1830 CG11254-RB 774..1710 954..19 4660 99.9 Minus
mael-RC 1839 CG11254-RC 783..1719 954..19 4660 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 19:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22725602..22726114 531..19 2565 100 Minus
3L 28110227 3L 22725116..22725542 954..529 2085 99.8 Minus
Blast to na_te.dros performed on 2015-02-04 19:30:14 has no hits.

BO04852.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:11:29 Download gff for BO04852.3prime
Subject Subject Range Query Range Percent Splice Strand
mael-PA 441..1380 15..954 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:28:30 Download gff for BO04852.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11254-PB 441..1380 15..954 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:17:56 Download gff for BO04852.3prime
Subject Subject Range Query Range Percent Splice Strand
mael-RA 703..1648 8..954 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:35:44 Download gff for BO04852.3prime
Subject Subject Range Query Range Percent Splice Strand
mael-RC 783..1728 8..954 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:35:44 Download gff for BO04852.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 22725605..22726123 8..528 99   Minus
3L 22725116..22725542 529..954 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:17:56 Download gff for BO04852.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22718705..22719223 8..528 99   Minus
arm_3L 22718216..22718642 529..954 99 -> Minus

BO04852.5prime Sequence

867 bp (841 high quality bases) assembled on 2005-11-29

> BO04852.5prime
GAAGTTATCAGTCGACATGGCTCCTAAGAAGCATAGTGGGTTTATGATGT
TCGTAAACGAGTGGAGAAACCGGAACGCCGAGGGCCGACGCATGACGCTG
GCGCAGGCTGTTTCCCACTGCGGCACCATATGGGAGAAAATGAACACCCA
GCAGCGTGGTCCGTACAACTCAGGCGGCAAGGACGCAAATGTGGCGCAAC
GCGCCAAAAGGGAAAGTTCCAACGGCCACGGCCAGGTGGACAAGGCCCAA
AGGGAGGCCACCGAGAGCTTGATGGACATGAAACGTACCATCGAGCGCCT
CGTGCTAAACGCCAAGATGTCCCATGATCTGGAGAATGCCAAGTTTGTCT
TCGTTGCCTTCAACTACTTCACTAAAGCCTTGACCACCGACGTCTATGTG
CCCGCCGAGTTTGCGGCATGCGAATATTCGTTGAAGGAGGGAATCCGATC
CATCTACAGCACCATGATTGACCCCGGTCAGATCATTTTTGGGCAAGGTA
GCGATGCCCTGCTTCACTCTTCAACCACTCACGACCTGCCGCTGCCGCCC
AACGCGCTGGGGGAGAAGAACATGACCAAGCTGTACCGCAACATTGTTGA
CTACTTATCCAAATGCCAGGGAAAAGGCAAGACCCTAGTAGTCTTTACAC
CCGCCGAAAATATTACCATGGTGAAGTCATGCTTCCGCTATTTGGAGTGC
GATGATGACTTCAGGGACGGGGGCGAAAAAATCCAGGTGTTTGATATCCA
GTACTTGCTATTCATATTGAAGAAGGAGGTCATGAATGTCGCTGATTTGA
ATGACGAGAAAATCAACAAATTCGCGACGGATGCTTTTTTTAAGAAAGAC
TTTTTCGAGTTTACCGC

BO04852.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11254-PA 1380 mael-RA 1..851 17..867 4255 100 Plus
CG11254-PB 1380 mael-RB 1..851 17..867 4255 100 Plus
CG11254-PC 1389 mael-RC 128..860 135..867 3665 100 Plus
CG11254-PC 1389 mael-RC 1..120 17..136 600 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
mael-RD 2143 CG11254-RD 647..1497 17..867 4255 100 Plus
mael-RB 1830 CG11254-RB 334..1184 17..867 4255 100 Plus
mael-RA 1759 CG11254-RA 263..1113 17..867 4255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22724985..22725526 326..867 2710 100 Plus
3L 28110227 3L 22724738..22724929 135..326 960 100 Plus
3L 28110227 3L 22724566..22724685 17..136 600 100 Plus
Blast to na_te.dros performed on 2015-02-11 15:41:35 has no hits.

BO04852.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:11:30 Download gff for BO04852.5prime
Subject Subject Range Query Range Percent Splice Strand
mael-PA 1..851 17..867 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:28:31 Download gff for BO04852.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11254-PB 1..851 17..867 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:34:45 Download gff for BO04852.5prime
Subject Subject Range Query Range Percent Splice Strand
mael-RA 257..1113 11..867 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:31:43 Download gff for BO04852.5prime
Subject Subject Range Query Range Percent Splice Strand
mael-RA 257..1113 11..867 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:31:43 Download gff for BO04852.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 22724986..22725526 327..867 100   Plus
3L 22724740..22724929 137..326 100 -> Plus
3L 22724560..22724685 11..136 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:34:45 Download gff for BO04852.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22718086..22718626 327..867 100   Plus
arm_3L 22717840..22718029 137..326 100 -> Plus
arm_3L 22717660..22717785 11..136 97 -> Plus

BO04852.complete Sequence

1411 bp (1411 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ629896

> BO04852.complete
GAAGTTATCAGTCGACATGGCTCCTAAGAAGCATAGTGGGTTTATGATGT
TCGTAAACGAGTGGAGAAACCGGAACGCCGAGGGCCGACGCATGACGCTG
GCGCAGGCTGTTTCCCACTGCGGCACCATATGGGAGAAAATGAACACCCA
GCAGCGTGGTCCGTACAACTCAGGCGGCAAGGACGCAAATGTGGCGCAAC
GCGCCAAAAGGGAAAGTTCCAACGGCCACGGCCAGGTGGACAAGGCCCAA
AGGGAGGCCACCGAGAGCTTGATGGACATGAAACGTACCATCGAGCGCCT
CGTGCTAAACGCCAAGATGTCCCATGATCTGGAGAATGCCAAGTTTGTCT
TCGTTGCCTTCAACTACTTCACTAAAGCCTTGACCACCGACGTCTATGTG
CCCGCCGAGTTTGCGGCATGCGAATATTCGTTGAAGGAGGGAATCCGATC
CATCTACAGCACCATGATTGACCCCGGTCAGATCATTTTTGGGCAAGGTA
GCGATGCCCTGCTTCACTCTTCAACCACTCACGACCTGCCGCTGCCGCCC
AACGCGCTGGGGGAGAAGAACATGACCAAGCTGTACCGCAACATTGTTGA
CTACTTATCCAAATGCCAGGGAAAAGGCAAGACCCTAGTAGTCTTTACAC
CCGCCGAAAATATTACCATGGTGAAGTCATGCTTCCGCTATTTGGAGTGC
GATGATGACTTCAGGGACGGGGGCGAAAAAATCCAGGTGTTTGATATCCA
GTACTTGCTATTCATATTGAAGAAGGAGGTCATGAATGTCGCTGATTTGA
ATGACGAGAAAATCAACAAATTCGCGACGGATGCTTTTTTTAAGAAAGAC
TTTTTCGAGTTTACCGCAGGGATTGCGTGTCAGTACCACGAGGATAATGA
TCGAACCAAGTACTGTACCCAGAGTATGGTGACTAGATGGGCGTATACCT
TCACTGATTTTATGTGCGGAGACCTGGCCATAACCGTCCAACCCGGAAAG
CACATACCTGCCCAAACAAAACCCAACTACCTTATCATAAGCTCGTACGC
CTCCTCACTCGACCACGAGTCCTCCTTCGACTCTTTTTATTCGCTTCCCG
GATCTGGGGTCAAGAAGGAAAGCCAACCCGAAGCTTGTTCGCTTTCTAGC
AGTCGACTTTCCGTCGCATCAAGCTCCTACAAGCCCATAGACCACACTTC
CTTTGCCGCAAATTTAAACGAAGTTTCTGAATTCCCCAGCCTCGGCATGC
GTAATTCTAGTAAGCATCACGGTATCGCCGCTAGTGCTCAGCGGGAATGG
AACGCTAGGAACTTACCGACGCACTCGCGTTTAATTCGGAAGGTTTCAGA
CAACGACTTCTCCGTAAACGGCGCTGATGGGAAACTTAAAAAAGCAAGCT
TTCTAGACCAT

BO04852.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
mael-RD 1380 CG11254-PD 1..1377 17..1393 6885 100 Plus
mael-RB 1380 CG11254-PB 1..1377 17..1393 6885 100 Plus
mael-RA 1380 CG11254-PA 1..1377 17..1393 6885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
mael-RD 2143 CG11254-RD 647..2023 17..1393 6885 100 Plus
mael-RB 1830 CG11254-RB 334..1710 17..1393 6885 100 Plus
mael-RA 1759 CG11254-RA 263..1639 17..1393 6885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22724985..22725542 326..883 2790 100 Plus
3L 28110227 3L 22725602..22726114 881..1393 2565 100 Plus
3L 28110227 3L 22724738..22724929 135..326 960 100 Plus
3L 28110227 3L 22724566..22724685 17..136 600 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:20:38 has no hits.

BO04852.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:31:14 Download gff for BO04852.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 1..1380 17..1397 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:58:01 Download gff for BO04852.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 327..1718 11..1404 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:35 Download gff for BO04852.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RA 263..1633 17..1387 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:31:14 Download gff for BO04852.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RB 327..1718 11..1404 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:16:23 Download gff for BO04852.complete
Subject Subject Range Query Range Percent Splice Strand
mael-RA 263..1633 17..1387 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:16:23 Download gff for BO04852.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22725605..22726108 884..1387 100   Plus
3L 22724986..22725542 327..883 100 -> Plus
3L 22724740..22724929 137..326 100 -> Plus
3L 22724566..22724685 17..136 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:35 Download gff for BO04852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22718705..22719208 884..1387 100   Plus
arm_3L 22718086..22718642 327..883 100 -> Plus
arm_3L 22717840..22718029 137..326 100 -> Plus
arm_3L 22717666..22717785 17..136 100 -> Plus

BO04852.pep Sequence

Translation from 16 to 1411

> BO04852.pep
MAPKKHSGFMMFVNEWRNRNAEGRRMTLAQAVSHCGTIWEKMNTQQRGPY
NSGGKDANVAQRAKRESSNGHGQVDKAQREATESLMDMKRTIERLVLNAK
MSHDLENAKFVFVAFNYFTKALTTDVYVPAEFAACEYSLKEGIRSIYSTM
IDPGQIIFGQGSDALLHSSTTHDLPLPPNALGEKNMTKLYRNIVDYLSKC
QGKGKTLVVFTPAENITMVKSCFRYLECDDDFRDGGEKIQVFDIQYLLFI
LKKEVMNVADLNDEKINKFATDAFFKKDFFEFTAGIACQYHEDNDRTKYC
TQSMVTRWAYTFTDFMCGDLAITVQPGKHIPAQTKPNYLIISSYASSLDH
ESSFDSFYSLPGSGVKKESQPEACSLSSSRLSVASSSYKPIDHTSFAANL
NEVSEFPSLGMRNSSKHHGIAASAQREWNARNLPTHSRLIRKVSDNDFSV
NGADGKLKKASFLDH

BO04852.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
mael-PD 459 CG11254-PD 1..459 1..459 2409 100 Plus
mael-PB 459 CG11254-PB 1..459 1..459 2409 100 Plus
mael-PA 459 CG11254-PA 1..459 1..459 2409 100 Plus
mael-PC 462 CG11254-PC 1..462 1..459 2395 99.4 Plus