Clone BO04865 Report

Search the DGRC for BO04865

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:48
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptRas85D-RA
Protein status:BO04865.pep: validated full length
Sequenced Size:601

Clone Sequence Records

BO04865.3prime Sequence

599 bp (598 high quality bases) assembled on 2005-12-02

> BO04865.3prime
ATGGTCTAGAAAGCTTGCGAGCATTTTACATTTAAATCTACGATTCGGCT
TGTTCATTTTGCGGCCCCTCCGCCCCTTGTTGTCCTTGTCCTTGCGGATT
TCGCGCACCAGTGTGTAAAATGCATCGTCCACGCCCATGCGCGTCTTGGC
GGATGTCTCAATGTATGGAATGCCGTACTGTTTGGCCACCTCTCTTGCCT
GCTCGTTGTTAACGTTCCACGAGGCCAGATCACATTTGTTGCCCACCAGC
ACCATGGGCACCTCTTCGGCATCCTTTACGCGCTTGATCTGCTCACGGTA
GGTGCCGATATCCTCGAAGGACTTCGCACTGTTGACGGCAAAGACCAGCA
GGAATCCCTCGCCAGTCCGCATATACTGATCCCGCATGGCCGAGTACTCC
TCTTGGCCGGCGGTGTCCAGGATGTCCAGCAGGCAGGTCTCTCCATCGAT
AACCACTTGCTTTCGGTAAGAGTCCTCGATTGTGGGGTCGTACTCGTCCA
CGAAATGGTTCTGGATTAGCTGGATGGTGAGCGCGGACTTGCCCACGCCT
CCGGCTCCAACGACGACCAGTTTGTATTCCGTCATGTCGACTGATAACT

BO04865.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9375-PA 570 Ras85D-RA 1..567 585..19 2835 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-RA 1958 CG9375-RA 442..1008 585..19 2835 100 Minus
R-RC 2702 CG1956-RC 615..849 576..342 320 76.3 Minus
R-RB 2872 CG1956-RB 785..1019 576..342 320 76.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9511737..9511997 187..447 1305 100 Plus
3R 32079331 3R 9511511..9511683 19..191 865 100 Plus
3R 32079331 3R 9512153..9512291 447..585 695 100 Plus
3L 28110227 3L 1860968..1861202 342..576 320 75.7 Plus
3L 28110227 3L 4140054..4140142 419..331 205 82 Minus
2R 25286936 2R 16109166..16109231 368..433 195 86.4 Plus
Blast to na_te.dros performed on 2015-02-11 15:41:56 has no hits.

BO04865.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:11:44 Download gff for BO04865.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9375-PA 1..570 15..585 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:28:52 Download gff for BO04865.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9375-PA 1..570 15..585 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:34:46 Download gff for BO04865.3prime
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 435..1011 15..593 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:31:49 Download gff for BO04865.3prime
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 435..1011 15..593 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:31:49 Download gff for BO04865.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 9512153..9512298 447..593 97   Plus
3R 9511740..9511996 190..446 100 <- Plus
3R 9511507..9511681 15..189 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:34:46 Download gff for BO04865.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5337875..5338020 447..593 97   Plus
arm_3R 5337462..5337718 190..446 100 <- Plus
arm_3R 5337229..5337403 15..189 98 <- Plus

BO04865.5prime Sequence

599 bp (598 high quality bases) assembled on 2005-11-29

> BO04865.5prime
GAAGTTATCAGTCGACATGACGGAATACAAACTGGTCGTCGTTGGAGCCG
GAGGCGTGGGCAAGTCCGCGCTCACCATCCAGCTAATCCAGAACCATTTC
GTGGACGAGTACGACCCCACAATCGAGGACTCTTACCGAAAGCAAGTGGT
TATCGATGGAGAGACCTGCCTGCTGGACATCCTGGACACCGCCGGCCAAG
AGGAGTACTCGGCCATGCGGGATCAGTATATGCGGACTGGCGAGGGATTC
CTGCTGGTCTTTGCCGTCAACAGTGCGAAGTCCTTCGAGGATATCGGCAC
CTACCGTGAGCAGATCAAGCGCGTAAAGGATGCCGAAGAGGTGCCCATGG
TGCTGGTGGGCAACAAATGTGATCTGGCCTCGTGGAACGTTAACAACGAG
CAGGCAAGAGAGGTGGCCAAACAGTACGGCATTCCATACATTGAGACATC
CGCCAAGACGCGCATGGGCGTGGACGATGCATTTTACACACTGGTGCGCG
AAATCCGCAAGGACAAGGACAACAAGGGGCGGAGGGGCCGCAAAATGAAC
AAGCCGAATCGTAGATTTAAATGTAAAATGCTCGCAAGCTTTCTAGACC

BO04865.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9375-PA 570 Ras85D-RA 1..567 17..583 2835 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-RA 1958 CG9375-RA 442..1008 17..583 2835 100 Plus
R-RC 2702 CG1956-RC 615..849 26..260 320 76.3 Plus
R-RB 2872 CG1956-RB 785..1019 26..260 320 76.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9511737..9511997 415..155 1305 100 Minus
3R 32079331 3R 9511511..9511683 583..411 865 100 Minus
3R 32079331 3R 9512153..9512291 155..17 695 100 Minus
3L 28110227 3L 1860968..1861202 260..26 320 75.7 Minus
3L 28110227 3L 4140054..4140142 183..271 205 82 Plus
2R 25286936 2R 16109166..16109231 234..169 195 86.4 Minus
Blast to na_te.dros performed on 2015-02-13 01:16:05 has no hits.

BO04865.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:11:45 Download gff for BO04865.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9375-PA 1..570 17..587 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:28:54 Download gff for BO04865.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9375-PA 1..570 17..587 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:08:02 Download gff for BO04865.5prime
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 435..1011 9..587 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:16:05 Download gff for BO04865.5prime
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 435..1011 9..587 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:16:05 Download gff for BO04865.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 9512153..9512298 9..155 97   Minus
3R 9511740..9511996 156..412 100 <- Minus
3R 9511507..9511681 413..587 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:08:02 Download gff for BO04865.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5337875..5338020 9..155 97   Minus
arm_3R 5337462..5337718 156..412 100 <- Minus
arm_3R 5337229..5337403 413..587 98 <- Minus

BO04865.complete Sequence

601 bp (601 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629902

> BO04865.complete
GAAGTTATCAGTCGACATGACGGAATACAAACTGGTCGTCGTTGGAGCCG
GAGGCGTGGGCAAGTCCGCGCTCACCATCCAGCTAATCCAGAACCATTTC
GTGGACGAGTACGACCCCACAATCGAGGACTCTTACCGAAAGCAAGTGGT
TATCGATGGAGAGACCTGCCTGCTGGACATCCTGGACACCGCCGGCCAAG
AGGAGTACTCGGCCATGCGGGATCAGTATATGCGGACTGGCGAGGGATTC
CTGCTGGTCTTTGCCGTCAACAGTGCGAAGTCCTTCGAGGATATCGGCAC
CTACCGTGAGCAGATCAAGCGCGTAAAGGATGCCGAAGAGGTGCCCATGG
TGCTGGTGGGCAACAAATGTGATCTGGCCTCGTGGAACGTTAACAACGAG
CAGGCAAGAGAGGTGGCCAAACAGTACGGCATTCCATACATTGAGACATC
CGCCAAGACGCGCATGGGCGTGGACGATGCATTTTACACACTGGTGCGCG
AAATCCGCAAGGACAAGGACAACAAGGGGCGGAGGGGCCGCAAAATGAAC
AAGCCGAATCGTAGATTTAAATGTAAAATGCTCGCAAGCTTTCTAGACCA
T

BO04865.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-RA 570 CG9375-PA 1..567 17..583 2835 100 Plus
R-RC 555 CG1956-PC 10..244 26..260 320 75.7 Plus
R-RB 555 CG1956-PB 10..244 26..260 320 75.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-RA 1958 CG9375-RA 442..1008 17..583 2835 100 Plus
R-RC 2702 CG1956-RC 615..849 26..260 320 75.7 Plus
R-RB 2872 CG1956-RB 785..1019 26..260 320 75.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9511737..9511997 415..155 1305 100 Minus
3R 32079331 3R 9511511..9511683 583..411 865 100 Minus
3R 32079331 3R 9512153..9512291 155..17 695 100 Minus
3L 28110227 3L 1860968..1861202 260..26 320 75.7 Minus
3L 28110227 3L 4140054..4140142 183..271 205 82 Plus
2R 25286936 2R 16109166..16109231 234..169 195 86.4 Minus
Blast to na_te.dros performed on 2014-11-27 20:48:06 has no hits.

BO04865.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:38:53 Download gff for BO04865.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 1..570 17..587 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:07:30 Download gff for BO04865.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 432..1008 9..587 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:14:14 Download gff for BO04865.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 442..1008 17..585 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:38:54 Download gff for BO04865.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 432..1008 9..587 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:28:31 Download gff for BO04865.complete
Subject Subject Range Query Range Percent Splice Strand
Ras85D-RA 442..1008 17..585 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:28:31 Download gff for BO04865.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9512153..9512291 17..155 100   Minus
3R 9511740..9511996 156..412 100 <- Minus
3R 9511509..9511681 413..585 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:14:14 Download gff for BO04865.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5337875..5338013 17..155 100   Minus
arm_3R 5337462..5337718 156..412 100 <- Minus
arm_3R 5337231..5337403 413..585 98 <- Minus

BO04865.pep Sequence

Translation from 16 to 601

> BO04865.pep
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQI
KRVKDAEEVPMVLVGNKCDLASWNVNNEQAREVAKQYGIPYIETSAKTRM
GVDDAFYTLVREIRKDKDNKGRRGRKMNKPNRRFKCKMLASFLDH

BO04865.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
Ras85D-PA 189 CG9375-PA 1..189 1..189 977 100 Plus
R-PC 184 CG1956-PC 1..178 1..182 515 54.1 Plus
R-PB 184 CG1956-PB 1..178 1..182 515 54.1 Plus
R-PA 184 CG1956-PA 1..178 1..182 515 54.1 Plus
Ras64B-PA 192 CG1167-PA 3..168 1..165 513 62.7 Plus