Clone BO04867 Report

Search the DGRC for BO04867

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:48
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptKlc-RA
Protein status:BO04867.pep: validated full length
Sequenced Size:1558

Clone Sequence Records

BO04867.3prime Sequence

901 bp (869 high quality bases) assembled on 2005-12-02

> BO04867.3prime
ATGGTCTAGAAAGCTTGCTGGTTTCGCATTCTTCTCCTCAGAGAAATCCA
AATCCTCTTTAATTGCCTTCGATCGTCGCTTTTCGTTTGACGTTAGCAAT
TGTGAGAGCTTCGTTTGTTTAGCTAGATCGTAGGCTTCTTTTTTACTCCG
CATTGCACAGTCTTCCAGGGTTTCGGCCGCTTCAAACATGCCTTGACGTC
GGTAAAGTGCTCCCAGATTTTTTAGAGTGGTTGTGACCGTGGGCGAATCC
ACTTTAGCGGCCTTATGCCAACCGCCGTACTCGCCATATGGAGTGTTCTC
CCTGTTATCGAATTTGTGCTCCTCACGCTCCTCAGCCACCTGCCAAATGG
GCTTGTTTTTGCTGTCGATGGCTCCAAACTCACGTTCGTGGGCTCGCGTC
AAGACCTGCTTATAGAGGATTTCAGCTTCGGTGTATCTACCTTGCTTCAG
ATAGCAGCCGGCCAGATTATTCTTTGTCTTGGCCACGTTGGGATCATCGG
GACCCAACTTTGATTCGTAGATGTCGAGAGCTCGCTGGTAGTACTTCTCA
ACCTCGTCGTATTTGCCCTGATTCTGGCAGAGCAGGGCGAGATTGTTAAG
TTGCTTGGCAACATCGGGATGATCCTTTCCCAGGACTTTCTCTCGGATCT
CCAAGGCACGCTTGCACAGTGGCTCGGCATCTTTGTACTTGCCACGTTTG
CCATAGAGGACGGCCAAGTTGTTCAACGTGGCCGCCACGGCTGGATGGTT
CTCGCCCAGTGTCTTTCCTCGAATCGACAGAGCGTCGTTGAGTAAATTGG
CGGCCTCCTTATACTTGTTCTGATCGCGGTACACGAGAGCCAAAATGTTC
AGCATGGTTGCTACATCGGGATGGTCGTGACCACTTTGTCTTTCGAGATC
T

BO04867.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5433-PA 1527 Klc-RA 657..1524 886..19 4340 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-RB 1841 CG5433-RB 759..1641 901..19 4370 99.8 Minus
Klc-RA 1843 CG5433-RA 761..1643 901..19 4370 99.8 Minus
Klc-RC 1876 CG5433-RC 797..1676 901..19 4315 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12747273..12747757 338..822 2425 100 Plus
3L 28110227 3L 12746898..12747206 34..342 1545 100 Plus
3L 28110227 3L 12747821..12747902 820..901 365 96.3 Plus
Blast to na_te.dros performed on 2015-02-11 04:48:59 has no hits.

BO04867.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:11:47 Download gff for BO04867.3prime
Subject Subject Range Query Range Percent Splice Strand
Klc-PA 642..1527 15..901 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:28:58 Download gff for BO04867.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5433-PA 642..1527 15..901 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:13:58 Download gff for BO04867.3prime
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 761..1646 15..901 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:19:20 Download gff for BO04867.3prime
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 761..1646 15..901 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:19:20 Download gff for BO04867.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 12747821..12747902 820..901 97   Plus
3L 12747275..12747754 340..819 100 <- Plus
3L 12746898..12747203 34..339 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:13:58 Download gff for BO04867.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12740921..12741002 820..901 97   Plus
arm_3L 12740375..12740854 340..819 100 <- Plus
arm_3L 12739998..12740303 34..339 100 <- Plus

BO04867.5prime Sequence

892 bp (805 high quality bases) assembled on 2005-11-29

> BO04867.5prime
GAAGTTATCAGTCGACATGACGCAAATGTCGCAGGACGAAATCATAACCA
ATACGAAAACAGTCCTTCAAGGCCTCGAAGCCTTGCGAGTGGAGCATGTT
TCGATTATGAACGGAATCGCCGAGGTGCAGAAGGACAATGAAAAGTCGGA
CATGCTGCGAAAGAACATCGAGAACATCGAACTGGGCCTCAGCGAGGCCC
AGGTGATGATGGCCCTGACATCCCATCTGCAGAACATCGAGGCCGAGAAG
CACAAGCTTAAGACACAGGTGCGCCGCCTCCACCAGGAGAACGCCTGGCT
TCGCGACGAGCTGGCCAACACTCAGCAAAAGTTCCAGGCATCCGAGCAGC
TGGTGGCCCAACTAGAGGAGGAGAAGAAGCACCTGGAGTTCATGGCGTCC
GTGAAGAAGTACGACGAGAATCAGGAGCAGGACGACGCTTGCGACAAGTC
CCGCACCGATCCCGTGGTCGAGCTATTCCCGGACGAGGAAAACGAGGACA
GACACAACATGTCGCCCACTCCGCCCAGCCAGTTCGCCAACCAGACTTCC
GGCTACGAGATTCCAGCGCGTCTCCGTACTCTGCACAACCTGGTCATTCA
GTATGCATCGCAGGGAAGATACGAGGTAGCCGTTCCCCTCTGCAAGCAAG
CATTGGAAGATCTCGAAAGGACAAGTGGTCACGACCATCCCGATGTAGCA
ACCATGCTGAACATTTTGGCTCTCGTGTACCGCGATCAGAACAAGTATAA
GGAGGCCGCCAATTTACTCAACGACGCTCTGTCGATTCGAGGAAAGACAC
TGGGCGAGAACCATCCAGCCGTGGCGGCCACGTTGAACAACTTGGCCGTC
CTCTATGGCAAACGTGGCAAGTACAAAGATGCCGAGCCACTG

BO04867.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5433-PA 1527 Klc-RA 1..876 17..892 4380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-RC 1876 CG5433-RC 156..1031 17..892 4380 100 Plus
Klc-RB 1841 CG5433-RB 118..993 17..892 4380 100 Plus
Klc-RA 1843 CG5433-RA 120..995 17..892 4380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12748056..12748657 618..17 3010 100 Minus
3L 28110227 3L 12747602..12747757 892..737 780 100 Minus
3L 28110227 3L 12747821..12747943 739..617 615 100 Minus
Blast to na_te.dros performed on 2015-02-11 02:32:36 has no hits.

BO04867.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:11:48 Download gff for BO04867.5prime
Subject Subject Range Query Range Percent Splice Strand
Klc-PA 1..876 17..892 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:28:59 Download gff for BO04867.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5433-PA 1..876 17..892 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:48:38 Download gff for BO04867.5prime
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 111..995 7..892 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:19:11 Download gff for BO04867.5prime
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 111..995 7..892 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:19:11 Download gff for BO04867.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 12748056..12748666 7..618 99   Minus
3L 12747821..12747941 619..739 100 <- Minus
3L 12747602..12747754 740..892 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:48:38 Download gff for BO04867.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12741156..12741766 7..618 99   Minus
arm_3L 12740921..12741041 619..739 100 <- Minus
arm_3L 12740702..12740854 740..892 100 <- Minus

BO04867.complete Sequence

1558 bp (1558 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ629904

> BO04867.complete
GAAGTTATCAGTCGACATGACGCAAATGTCGCAGGACGAAATCATAACCA
ATACGAAAACAGTCCTTCAAGGCCTCGAAGCCTTGCGAGTGGAGCATGTT
TCGATTATGAACGGAATCGCCGAGGTGCAGAAGGACAATGAAAAGTCGGA
CATGCTGCGAAAGAACATCGAGAACATCGAACTGGGCCTCAGCGAGGCCC
AGGTGATGATGGCCCTGACATCCCATCTGCAGAACATCGAGGCCGAGAAG
CACAAGCTTAAGACACAGGTGCGCCGCCTCCACCAGGAGAACGCCTGGCT
TCGCGACGAGCTGGCCAACACTCAGCAAAAGTTCCAGGCATCCGAGCAGC
TGGTGGCCCAACTAGAGGAGGAGAAGAAGCACCTGGAGTTCATGGCGTCC
GTGAAGAAGTACGACGAGAATCAGGAGCAGGACGACGCTTGCGACAAGTC
CCGCACCGATCCCGTGGTCGAGCTATTCCCGGACGAGGAAAACGAGGACA
GACACAACATGTCGCCCACTCCGCCCAGCCAGTTCGCCAACCAGACTTCC
GGCTACGAGATTCCAGCGCGTCTCCGTACTCTGCACAACCTGGTCATTCA
GTATGCATCGCAGGGAAGATACGAGGTAGCCGTTCCCCTCTGCAAGCAAG
CATTGGAAGATCTCGAAAGGACAAGTGGTCACGACCATCCCGATGTAGCA
ACCATGCTGAACATTTTGGCTCTCGTGTACCGCGATCAGAACAAGTATAA
GGAGGCCGCCAATTTACTCAACGACGCTCTGTCGATTCGAGGAAAGACAC
TGGGCGAGAACCATCCAGCCGTGGCGGCCACGTTGAACAACTTGGCCGTC
CTCTATGGCAAACGTGGCAAGTACAAAGATGCCGAGCCACTGTGCAAGCG
TGCCTTGGAGATCCGAGAGAAAGTCCTGGGAAAGGATCATCCCGATGTTG
CCAAGCAACTTAACAATCTCGCCCTGCTCTGCCAGAATCAGGGCAAATAC
GACGAGGTTGAGAAGTACTACCAGCGAGCTCTCGACATCTACGAATCAAA
GTTGGGTCCCGATGATCCCAACGTGGCCAAGACAAAGAATAATCTGGCCG
GCTGCTATCTGAAGCAAGGTAGATACACCGAAGCTGAAATCCTCTATAAG
CAGGTCTTGACGCGAGCCCACGAACGTGAGTTTGGAGCCATCGACAGCAA
AAACAAGCCCATTTGGCAGGTGGCTGAGGAGCGTGAGGAGCACAAATTCG
ATAACAGGGAGAACACTCCATATGGCGAGTACGGCGGTTGGCATAAGGCC
GCTAAAGTGGATTCGCCCACGGTCACAACCACTCTAAAAAATCTGGGAGC
ACTTTACCGACGTCAAGGCATGTTTGAAGCGGCCGAAACCCTGGAAGACT
GTGCAATGCGGAGTAAAAAAGAAGCCTACGATCTAGCTAAACAAACGAAG
CTCTCACAATTGCTAACGTCAAACGAAAAGCGACGATCGAAGGCAATTAA
AGAGGATTTGGATTTCTCTGAGGAGAAGAATGCGAAACCAGCAAGCTTTC
TAGACCAT

BO04867.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-RB 1527 CG5433-PB 1..1524 17..1540 7620 100 Plus
Klc-RA 1527 CG5433-PA 1..1524 17..1540 7620 100 Plus
Klc-RC 1524 CG5433-PC 1..1511 17..1527 7555 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-RB 1841 CG5433-RB 118..1641 17..1540 7620 100 Plus
Klc-RA 1843 CG5433-RA 120..1643 17..1540 7620 100 Plus
Klc-RC 1876 CG5433-RC 156..1666 17..1527 7555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12748056..12748657 618..17 3010 100 Minus
3L 28110227 3L 12747273..12747757 1221..737 2425 100 Minus
3L 28110227 3L 12746898..12747206 1525..1217 1545 100 Minus
3L 28110227 3L 12747821..12747943 739..617 615 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:06:11 has no hits.

BO04867.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:31:03 Download gff for BO04867.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 1..1527 17..1544 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:57:48 Download gff for BO04867.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 111..1646 7..1544 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:06:49 Download gff for BO04867.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 120..1643 17..1542 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:31:04 Download gff for BO04867.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 111..1646 7..1544 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:14:51 Download gff for BO04867.complete
Subject Subject Range Query Range Percent Splice Strand
Klc-RA 120..1643 17..1542 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:14:51 Download gff for BO04867.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12748056..12748657 17..618 100   Minus
3L 12747821..12747941 619..739 100 <- Minus
3L 12747275..12747754 740..1219 100 <- Minus
3L 12746898..12747203 1220..1525 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:06:49 Download gff for BO04867.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12741156..12741757 17..618 100   Minus
arm_3L 12740921..12741041 619..739 100 <- Minus
arm_3L 12740375..12740854 740..1219 100 <- Minus
arm_3L 12739998..12740303 1220..1525 100 <- Minus

BO04867.pep Sequence

Translation from 16 to 1558

> BO04867.pep
MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKN
IENIELGLSEAQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELA
NTQQKFQASEQLVAQLEEEKKHLEFMASVKKYDENQEQDDACDKSRTDPV
VELFPDEENEDRHNMSPTPPSQFANQTSGYEIPARLRTLHNLVIQYASQG
RYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRDQNKYKEAANL
LNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDD
PNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIW
QVAEEREEHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQ
GMFEAAETLEDCAMRSKKEAYDLAKQTKLSQLLTSNEKRRSKAIKEDLDF
SEEKNAKPASFLDH

BO04867.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Klc-PB 508 CG5433-PB 1..508 1..508 2623 100 Plus
Klc-PA 508 CG5433-PA 1..508 1..508 2623 100 Plus
Klc-PC 507 CG5433-PC 1..507 1..508 2606 99.8 Plus