Clone BO05416 Report

Search the DGRC for BO05416

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:54
Well:16
Vector:pDNR-Dual
Associated Gene/Transcriptcm-RA
Protein status:BO05416.pep: validated full length
Sequenced Size:1279

Clone Sequence Records

BO05416.3prime Sequence

902 bp (882 high quality bases) assembled on 2005-12-02

> BO05416.3prime
ATGGTCTAGAAAGCTTGCCATCCGCACCTGGAACTTGCCCGCCTTGGTCA
GGTATTTGACGCCCTTGAAAGGCTTGTACTTCTCGCCGTACATGTCCAGG
CGATTTACCTTTAGCCCAGAGACGGCCAGCTGCGAGATTTGGAACTGGAC
ATTCACGGATGGATTGGCATCGATGTTGGTCGTACCGGGCGTAATGGAAA
CCGATCCCCTAATATTTGGCAACTTGGAAACATCGATCCGTCCCACATCC
CAGGACAGCGTCTTGGTCACCGAATCGAAGGTATACTTTCCCTGATTCGG
CGTCAATAGGCAATTAAGCACACACCGCGGCATGGTCAGCTCCAGCTTCA
CCTTGTCAACGGTGCGACCAAGGGTGTTCCTCGGGCCAATCGTGAGGTCC
AGACGCCCCTGCTCACCCGTTTTGATCGAAAAGTTGTGCCTGATGTAGAT
GGGTATGGCCACCACGGACTGAGAGCTAATGTGATATGACATCAGGCGGA
AGTTTCCGTCGGGCGGGATAAAGGAGAGCAGGCGCTCCGCCTCCCAGCGC
TTGTAGCGCACGCAAGGATGGAAGGAAACGTCGTCGAAGAGGCGAGGATT
CATGAAAGATAACGTCAGATCTGGCATGCCGGATAACTTAATGCAGCAGT
CGATGTGTCCCTGGATCTCGGCAAAGACCGTGGATCCGGATTTATCAATG
ATAGCGTCCACCTCCTCGATGACATCGAAGTACGCCTCGTTGTTGGTGTA
CCTCACGCCGCTTCTGCGCCAGCGAACCGCCGACAGCTGACCCGAGGGCA
AAGTAGTGCTTACATTGCTCTTGCCCGTCACCGTGTTGGCAATGGTGCGC
AGGATATTGGGCGGCTTGATCAGCTCCTTGAGGATGTTGCTCTCGGTGGC
CA

BO05416.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG3035-PA 1248 cm-RA 362..1245 902..19 4420 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
cm-RB 1774 CG3035-RB 416..1299 902..19 4420 100 Minus
cm-RA 1469 CG3035-RA 416..1299 902..19 4420 100 Minus
Inx7-RB 1690 CG2977-RB 1..271 297..27 1355 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7009772..7010226 200..654 2275 100 Plus
X 23542271 X 7009481..7009664 19..202 920 100 Plus
X 23542271 X 7010283..7010442 655..814 800 100 Plus
X 23542271 X 7010519..7010606 815..902 440 100 Plus
Blast to na_te.dros performed on 2015-02-13 02:24:20 has no hits.

BO05416.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 02:21:28 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:42:53 Download gff for BO05416.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3035-PA 363..1248 18..901 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:36:45 Download gff for BO05416.3prime
Subject Subject Range Query Range Percent Splice Strand
cm-RA 417..1299 19..901 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:29:46 Download gff for BO05416.3prime
Subject Subject Range Query Range Percent Splice Strand
cm-RA 417..1299 19..901 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 06:29:46 Download gff for BO05416.3prime
Subject Subject Range Query Range Percent Splice Strand
X 7010519..7010605 815..901 100   Plus
X 7010283..7010442 655..814 100 <- Plus
X 7009774..7010226 202..654 100 <- Plus
X 7009481..7009663 19..201 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:36:45 Download gff for BO05416.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6904552..6904638 815..901 100   Plus
arm_X 6904316..6904475 655..814 100 <- Plus
arm_X 6903807..6904259 202..654 100 <- Plus
arm_X 6903514..6903696 19..201 100 <- Plus

BO05416.5prime Sequence

898 bp (814 high quality bases) assembled on 2005-12-02

> BO05416.5prime
GAAGTTATCAGTCGACATGATACACAGTCTGTTTATTGTAAACAGCGGCG
GCGAGGTCTTCCTGGAAAAGCATTGGCGCTCGGTTGTCTCGAGATCTGTG
TGCGAATACTTCCTTGACGCCCAGCGCGCTGCTCCATATGATGTGCCGCC
GGTGATAGCCACGCCCCACTACTACCTGATTACAGTGCAAAGGGACACGG
TGTCTTTGGTCGCCGCCTGCAAGCAGGAGGTGCCGCCGCTCTTTGTCATC
GAGTTCCTGCATCGCGTGGTGGACACCTTCCAGGACTATTTCGGCGACTG
CTCCGAGTCCGTGATCAAGGACAACTATGTGGTCGTTTACGAGCTGCTGG
ACGAGATGCTCGATAATGGCTTCCCACTGGCCACCGAGAGCAACATCCTC
AAGGAGCTGATCAAGCCGCCCAATATCCTGCGCACCATTGCCAACACGGT
GACGGGCAAGAGCAATGTAAGCACTACTTTGCCCTCGGGTCAGCTGTCGG
CGGTTCGCTGGCGCAGAAGCGGCGTGAGGTACACCAACAACGAGGCGTAC
TTCGATGTCATCGAGGAGGTGGACGCTATCATTGATAAATCCGGATCCAC
GGTCTTTGCCGAGATCCAGGGACACATCGACTGCTGCATTAAGTTATCCG
GCATGCCAGATCTGACGTTATCTTTCATGAATCCTCGCCTCTTCGACGAC
GTTTCCTTCCATCCTTGCGTGCGCTACAAGCGCTGGGAGGCGGAGCGCCT
GCTCTCCTTTATCCCGCCCGACGGAAACTTCCGCCTGATGTCATATCACA
TTAGCTCTCAGTCCGTGGTGGCCATACCCATCTACATCAGGCACAACTTT
TCGATCAAAACGGGTGAGCAGGGGCGTCTGGACCTCACGATTGGCCCG

BO05416.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3035-PA 1248 cm-RA 1..882 17..898 4410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
cm-RB 1774 CG3035-RB 55..936 17..898 4410 100 Plus
cm-RA 1469 CG3035-RA 55..936 17..898 4410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7010519..7010844 465..140 1630 100 Minus
X 23542271 X 7009954..7010226 898..626 1365 100 Minus
X 23542271 X 7010283..7010442 625..466 800 100 Minus
X 23542271 X 7010899..7010988 140..51 450 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:17:12 has no hits.

BO05416.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 02:21:29 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:42:55 Download gff for BO05416.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3035-PA 1..882 17..898 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:55:29 Download gff for BO05416.5prime
Subject Subject Range Query Range Percent Splice Strand
cm-RA 47..936 11..898 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:02:22 Download gff for BO05416.5prime
Subject Subject Range Query Range Percent Splice Strand
cm-RA 47..936 11..898 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:02:22 Download gff for BO05416.5prime
Subject Subject Range Query Range Percent Splice Strand
X 7011057..7011099 11..51 93   Minus
X 7010900..7010987 52..139 100 <- Minus
X 7010519..7010844 140..465 100 <- Minus
X 7010283..7010442 466..625 100 <- Minus
X 7009954..7010226 626..898 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:55:29 Download gff for BO05416.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905090..6905132 11..51 93   Minus
arm_X 6904933..6905020 52..139 100 <- Minus
arm_X 6904552..6904877 140..465 100 <- Minus
arm_X 6904316..6904475 466..625 100 <- Minus
arm_X 6903987..6904259 626..898 100 <- Minus

BO05416.complete Sequence

1279 bp (1279 high quality bases) assembled on 2005-09-12

GenBank Submission: FJ630023

> BO05416.complete
GAAGTTATCAGTCGACATGATACACAGTCTGTTTATTGTAAACAGCGGCG
GCGAGGTCTTCCTGGAAAAGCATTGGCGCTCGGTTGTCTCGAGATCTGTG
TGCGAATACTTCCTTGACGCCCAGCGCGCTGCTCCATATGATGTGCCGCC
GGTGATAGCCACGCCCCACTACTACCTGATTACAGTGCAAAGGGACACGG
TGTCTTTGGTCGCCGCCTGCAAGCAGGAGGTGCCGCCGCTCTTTGTCATC
GAGTTCCTGCATCGCGTGGTGGACACCTTCCAGGACTATTTCGGCGACTG
CTCCGAGTCCGTGATCAAGGACAACTATGTGGTCGTTTACGAGCTGCTGG
ACGAGATGCTCGATAATGGCTTCCCACTGGCCACCGAGAGCAACATCCTC
AAGGAGCTGATCAAGCCGCCCAATATCCTGCGCACCATTGCCAACACGGT
GACGGGCAAGAGCAATGTAAGCACTACTTTGCCCTCGGGTCAGCTGTCGG
CGGTTCGCTGGCGCAGAAGCGGCGTGAGGTACACCAACAACGAGGCGTAC
TTCGATGTCATCGAGGAGGTGGACGCTATCATTGATAAATCCGGATCCAC
GGTCTTTGCCGAGATCCAGGGACACATCGACTGCTGCATTAAGTTATCCG
GCATGCCAGATCTGACGTTATCTTTCATGAATCCTCGCCTCTTCGACGAC
GTTTCCTTCCATCCTTGCGTGCGCTACAAGCGCTGGGAGGCGGAGCGCCT
GCTCTCCTTTATCCCGCCCGACGGAAACTTCCGCCTGATGTCATATCACA
TTAGCTCTCAGTCCGTGGTGGCCATACCCATCTACATCAGGCACAACTTT
TCGATCAAAACGGGTGAGCAGGGGCGTCTGGACCTCACGATTGGCCCGAG
GAACACCCTTGGTCGCACCGTTGACAAGGTGAAGCTGGAGCTGACCATGC
CGCGGTGTGTGCTTAATTGCCTATTGACGCCGAATCAGGGAAAGTATACC
TTCGATTCGGTGACCAAGACGCTGTCCTGGGATGTGGGACGGATCGATGT
TTCCAAGTTGCCAAATATTAGGGGATCGGTTTCCATTACGCCCGGTACGA
CCAACATCGATGCCAATCCATCCGTGAATGTCCAGTTCCAAATCTCGCAG
CTGGCCGTCTCTGGGCTAAAGGTAAATCGCCTGGACATGTACGGCGAGAA
GTACAAGCCTTTCAAGGGCGTCAAATACCTGACCAAGGCGGGCAAGTTCC
AGGTGCGGATGGCAAGCTTTCTAGACCAT

BO05416.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
cm-RB 1248 CG3035-PB 1..1245 17..1261 6225 100 Plus
cm-RA 1248 CG3035-PA 1..1245 17..1261 6225 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
cm-RB 1774 CG3035-RB 55..1299 17..1261 6225 100 Plus
cm-RA 1469 CG3035-RA 55..1299 17..1261 6225 100 Plus
Inx7-RB 1690 CG2977-RB 1..271 983..1253 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7009772..7010226 1080..626 2275 100 Minus
X 23542271 X 7010519..7010844 465..140 1630 100 Minus
X 23542271 X 7009481..7009664 1261..1078 920 100 Minus
X 23542271 X 7010283..7010442 625..466 800 100 Minus
X 23542271 X 7010899..7010988 140..51 450 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:36:06 has no hits.

BO05416.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:38:03 Download gff for BO05416.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 1..1248 17..1262 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:06:26 Download gff for BO05416.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 37..1289 11..1261 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:28 Download gff for BO05416.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 55..1299 17..1263 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:38:04 Download gff for BO05416.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 37..1289 11..1261 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:15:03 Download gff for BO05416.complete
Subject Subject Range Query Range Percent Splice Strand
cm-RA 55..1299 17..1263 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:15:03 Download gff for BO05416.complete
Subject Subject Range Query Range Percent Splice Strand
X 7011057..7011091 17..51 100   Minus
X 7010900..7010987 52..139 100 <- Minus
X 7010519..7010844 140..465 100 <- Minus
X 7010283..7010442 466..625 100 <- Minus
X 7009774..7010226 626..1078 100 <- Minus
X 7009479..7009663 1079..1263 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:28 Download gff for BO05416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905090..6905124 17..51 100   Minus
arm_X 6904933..6905020 52..139 100 <- Minus
arm_X 6904552..6904877 140..465 100 <- Minus
arm_X 6904316..6904475 466..625 100 <- Minus
arm_X 6903807..6904259 626..1078 100 <- Minus
arm_X 6903512..6903696 1079..1263 98 <- Minus

BO05416.pep Sequence

Translation from 16 to 1279

> BO05416.pep
MIHSLFIVNSGGEVFLEKHWRSVVSRSVCEYFLDAQRAAPYDVPPVIATP
HYYLITVQRDTVSLVAACKQEVPPLFVIEFLHRVVDTFQDYFGDCSESVI
KDNYVVVYELLDEMLDNGFPLATESNILKELIKPPNILRTIANTVTGKSN
VSTTLPSGQLSAVRWRRSGVRYTNNEAYFDVIEEVDAIIDKSGSTVFAEI
QGHIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRYKRWEAERLLSFIP
PDGNFRLMSYHISSQSVVAIPIYIRHNFSIKTGEQGRLDLTIGPRNTLGR
TVDKVKLELTMPRCVLNCLLTPNQGKYTFDSVTKTLSWDVGRIDVSKLPN
IRGSVSITPGTTNIDANPSVNVQFQISQLAVSGLKVNRLDMYGEKYKPFK
GVKYLTKAGKFQVRMASFLDH

BO05416.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
cm-PB 415 CG3035-PB 1..415 1..415 2163 100 Plus
cm-PA 415 CG3035-PA 1..415 1..415 2163 100 Plus
AP-1mu-PA 426 CG9388-PA 5..424 4..414 450 27.4 Plus
AP-2mu-PC 437 CG7057-PC 1..436 1..414 416 27.3 Plus
AP-2mu-PB 437 CG7057-PB 1..436 1..414 416 27.3 Plus