Clone BO05421 Report

Search the DGRC for BO05421

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:54
Well:21
Vector:pDNR-Dual
Associated Gene/Transcripttan-RA
Protein status:BO05421.pep: validated full length
Sequenced Size:931

Clone Sequence Records

BO05421.3prime Sequence

929 bp (876 high quality bases) assembled on 2005-12-02

> BO05421.3prime
ATGGTCTAGAAAGCTTGCCTCAAAGCCCGCCGGTTGCATGAGGAACTGGT
GCTGGCTGCTCATTGTCGGCAGCTGTATGTCTTCCATGGTCATGGATGTC
TTGGGGATGTTGACGGCCTCCGCCGATCCTCCCGCCTCTGCATCATCCCC
CTCCAGCATGGCACTGTCGAAGCTCTTATTCAGACGATCGTGGAACTCGG
TCATGGAGATTTTCTTGAGTGCGAAACGCTTGCCAAAGGTCTTCTTCACC
TTCTGGCGGCGTCTCTTCGACAGGATTTTGTTCTTGTTCAGGCCATCGCT
GAAGGATATTGCCCGGCGGAGTTTGCGACCCCACACCTTAACTACTTTCA
CTTGGCTGCTGATGGAGCACTCTTCGCTGTCGTCCTCTGCATCGGCGGCA
TTCTCATCGCTGGGTTCCTCGAAGATTGTCTCCAGATTGGTGGGCGTGAA
CTTTTTCATGCGCCTGCTGGTGTAGATCTTTTCGATGCTTTTAAGTGTTT
GGGCATTTGTGTTCAGTTCTTTGCGTTGCTTCTTTTTGATGGGTTTCATG
ATGGCGCTGCAGATCCGGTTAAAGTTGTCCTTGGACACCCTGGCGGGCAT
TCTGCGACGAGCCACGCCCGCTCGAGCTCCAAAAGTGGAACTGCGTCTGG
AGGATCCACTGATGCAATCGCTGTCGTCATCGTTGTCCTCGCAGCGACTC
AATTGCGAGTCTACATCGTCGGAGTCATGCGATTCACTGCTGACATTGTC
ATCGGATTCGGGTGGAGCTATGGGCTCGGATGTGTCCTGCATCTCCTCCA
TGTCCGACAAGGCCATCTGATTTAGTTGCCACGACAGATTCGAGTTAGTA
GTGGGTGACCTGTTGTCTTTTGCTTGAAACGTGATCTTGGCAAAGTCGTA
GACTATGTTATCCATGTCGACTGATAACT

BO05421.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG6586-PA 900 tan-RA 1..897 915..19 4485 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
tan-RB 1657 CG6586-RB 316..1212 915..19 4485 100 Minus
tan-RA 1494 CG6586-RA 316..1212 915..19 4485 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 01:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6055714..6056557 862..19 4220 100 Minus
3L 28110227 3L 6055608..6055665 915..858 290 100 Minus
Blast to na_te.dros performed on 2015-02-12 01:18:37 has no hits.

BO05421.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:21:37 Download gff for BO05421.3prime
Subject Subject Range Query Range Percent Splice Strand
tan-PA 1..900 18..915 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:43:07 Download gff for BO05421.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6586-PA 1..900 18..915 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:40:53 Download gff for BO05421.3prime
Subject Subject Range Query Range Percent Splice Strand
tan-RA 316..1212 19..915 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:28:43 Download gff for BO05421.3prime
Subject Subject Range Query Range Percent Splice Strand
tan-RA 316..1212 19..915 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 05:28:43 Download gff for BO05421.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 6055717..6056557 19..859 100   Minus
3L 6055608..6055663 860..915 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:40:53 Download gff for BO05421.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6048817..6049657 19..859 100   Minus
arm_3L 6048708..6048763 860..915 100 -> Minus

BO05421.5prime Sequence

902 bp (809 high quality bases) assembled on 2005-12-02

> BO05421.5prime
GAAGTTATCAGTCGACATGGATAACATAGTCTACGACTTTGCCAAGATCA
CGTTTCAAGCAAAAGACAACAGGTCACCCACTACTAACTCGAATCTGTCG
TGGCAACTAAATCAGATGGCCTTGTCGGACATGGAGGAGATGCAGGACAC
ATCCGAGCCCATAGCTCCACCCGAATCCGATGACAATGTCAGCAGTGAAT
CGCATGACTCCGACGATGTAGACTCGCAATTGAGTCGCTGCGAGGACAAC
GATGACGACAGCGATTGCATCAGTGGATCCTCCAGACGCAGTTCCACTTT
TGGAGCTCGAGCGGGCGTGGCTCGTCGCAGAATGCCCGCCAGGGTGTCCA
AGGACAACTTTAACCGGATCTGCAGCGCCATCATGAAACCCATCAAAAAG
AAGCAACGCAAAGAACTGAACACAAATGCCCAAACACTTAAAAGCATCGA
AAAGATCTACACCAGCAGGCGCATGAAAAAGTTCACGCCCACCAATCTGG
AGACAATCTTCGAGGAACCCAGCGATGAGAATGCCGCCGATGCAGAGGAC
GACAGCGAAGAGTGCTCCATCAGCAGCCAAGTGAAAGTAGTTAAGGTGTG
GGGTCGCAAACTCCGCCGGGCAATATCCTTCAGCGATGGCCTGAACAAGA
ACAAAATCCTGTCGAAGAGACGCCGCCAGAAGGTGAAGAAGACCTTTGGC
AAGCGTTTCGCACTCAAGAAAATCTCCATGACCGAGTTCCACGATCGTCT
GAATAAGAGCTTCGACAGTGCCATGCTGGAGGGGGATGATGCAGAGGCGG
GAGGATCGGCGGAGGCCGTCAACATCCCCAAGACATCCATGACCATGGAA
GACATACAGCTGCCGACAATGAGCAGCCAGCACCAGTTCCTCATGCAACC
CG

BO05421.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG6586-PA 900 tan-RA 1..884 17..900 4420 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
tan-RB 1657 CG6586-RB 316..1199 17..900 4420 100 Plus
tan-RA 1494 CG6586-RA 316..1199 17..900 4420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6055714..6056544 70..900 4155 100 Plus
3L 28110227 3L 6055608..6055665 17..74 290 100 Plus
Blast to na_te.dros performed on 2015-02-13 02:24:38 has no hits.

BO05421.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:21:38 Download gff for BO05421.5prime
Subject Subject Range Query Range Percent Splice Strand
tan-PA 1..885 17..902 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:43:09 Download gff for BO05421.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6586-PA 1..885 17..902 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:36:49 Download gff for BO05421.5prime
Subject Subject Range Query Range Percent Splice Strand
tan-RA 316..1200 17..902 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:30:47 Download gff for BO05421.5prime
Subject Subject Range Query Range Percent Splice Strand
tan-RA 316..1200 17..902 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 06:30:47 Download gff for BO05421.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6055717..6056545 73..902 99   Plus
3L 6055608..6055663 17..72 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:36:49 Download gff for BO05421.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6048817..6049645 73..902 99   Plus
arm_3L 6048708..6048763 17..72 100 -> Plus

BO05421.complete Sequence

931 bp (931 high quality bases) assembled on 2005-09-12

GenBank Submission: FJ630027

> BO05421.complete
GAAGTTATCAGTCGACATGGATAACATAGTCTACGACTTTGCCAAGATCA
CGTTTCAAGCAAAAGACAACAGGTCACCCACTACTAACTCGAATCTGTCG
TGGCAACTAAATCAGATGGCCTTGTCGGACATGGAGGAGATGCAGGACAC
ATCCGAGCCCATAGCTCCACCCGAATCCGATGACAATGTCAGCAGTGAAT
CGCATGACTCCGACGATGTAGACTCGCAATTGAGTCGCTGCGAGGACAAC
GATGACGACAGCGATTGCATCAGTGGATCCTCCAGACGCAGTTCCACTTT
TGGAGCTCGAGCGGGCGTGGCTCGTCGCAGAATGCCCGCCAGGGTGTCCA
AGGACAACTTTAACCGGATCTGCAGCGCCATCATGAAACCCATCAAAAAG
AAGCAACGCAAAGAACTGAACACAAATGCCCAAACACTTAAAAGCATCGA
AAAGATCTACACCAGCAGGCGCATGAAAAAGTTCACGCCCACCAATCTGG
AGACAATCTTCGAGGAACCCAGCGATGAGAATGCCGCCGATGCAGAGGAC
GACAGCGAAGAGTGCTCCATCAGCAGCCAAGTGAAAGTAGTTAAGGTGTG
GGGTCGCAAACTCCGCCGGGCAATATCCTTCAGCGATGGCCTGAACAAGA
ACAAAATCCTGTCGAAGAGACGCCGCCAGAAGGTGAAGAAGACCTTTGGC
AAGCGTTTCGCACTCAAGAAAATCTCCATGACCGAGTTCCACGATCGTCT
GAATAAGAGCTTCGACAGTGCCATGCTGGAGGGGGATGATGCAGAGGCGG
GAGGATCGGCGGAGGCCGTCAACATCCCCAAGACATCCATGACCATGGAA
GACATACAGCTGCCGACAATGAGCAGCCAGCACCAGTTCCTCATGCAACC
GGCGGGCTTTGAGGCAAGCTTTCTAGACCAT

BO05421.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
tan-RB 900 CG6586-PB 1..897 17..913 4485 100 Plus
tan-RA 900 CG6586-PA 1..897 17..913 4485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
tan-RB 1657 CG6586-RB 316..1212 17..913 4485 100 Plus
tan-RA 1494 CG6586-RA 316..1212 17..913 4485 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6055714..6056557 70..913 4220 100 Plus
3L 28110227 3L 6055608..6055665 17..74 290 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:15:46 has no hits.

BO05421.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:37:55 Download gff for BO05421.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 1..900 17..914 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:06:15 Download gff for BO05421.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 274..1170 17..913 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:18 Download gff for BO05421.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 316..1212 17..915 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:37:55 Download gff for BO05421.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 274..1170 17..913 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:55 Download gff for BO05421.complete
Subject Subject Range Query Range Percent Splice Strand
tan-RA 316..1212 17..915 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:55 Download gff for BO05421.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6055717..6056557 73..915 99   Plus
3L 6055608..6055663 17..72 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:18 Download gff for BO05421.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6048817..6049657 73..915 99   Plus
arm_3L 6048708..6048763 17..72 100 -> Plus

BO05421.pep Sequence

Translation from 16 to 931

> BO05421.pep
MDNIVYDFAKITFQAKDNRSPTTNSNLSWQLNQMALSDMEEMQDTSEPIA
PPESDDNVSSESHDSDDVDSQLSRCEDNDDDSDCISGSSRRSSTFGARAG
VARRRMPARVSKDNFNRICSAIMKPIKKKQRKELNTNAQTLKSIEKIYTS
RRMKKFTPTNLETIFEEPSDENAADAEDDSEECSISSQVKVVKVWGRKLR
RAISFSDGLNKNKILSKRRRQKVKKTFGKRFALKKISMTEFHDRLNKSFD
SAMLEGDDAEAGGSAEAVNIPKTSMTMEDIQLPTMSSQHQFLMQPAGFEA
SFLDH

BO05421.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
tan-PB 299 CG6586-PB 1..299 1..299 1525 100 Plus
tan-PA 299 CG6586-PA 1..299 1..299 1525 100 Plus