Clone BO05602 Report

Search the DGRC for BO05602

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:56
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptTbp-1-RA
Protein status:BO05602.pep: validated full length
Sequenced Size:1318

Clone Sequence Records

BO05602.3prime Sequence

933 bp (855 high quality bases) assembled on 2005-12-02

> BO05602.3prime
ATGGTCTAGAAAGCTTGCAGCGTAGTAGTTAAGATTAGCCTTCTTCTTCG
CCTGCACTTCCATGATGGCGTCCATGAAGTCTTCGTGCGTAACCGAATTG
GCGGAGCGACGCAGTGCGATCATACCAGCTTCCACACAGACGGCTTTGCA
CTGGGCGCCGTTGAAGTCATCCGTGGATCGGGACAATTCCTCGAAATTCA
CATCATTGCTAACGTTCATTTTACGCGAGTGAATCTGCATAATACGGGCA
CGGGCTTCCTCGTTGGGATGTGGGAACTCGATCTTACGATCCAGACGACC
AGAGCGCAGCAGAGCAGGATCCAGAATGTCTACGCGATTGGTGGCCGCAA
TCACCTTAATATCTGCAGTGGAACTGAAGCCATCGAGCTGATTAAGAAGC
TCCAACATAGTTCGCTGGACCTCACGGTCACCGGCCTTCTCCGAATCGAA
ACGCTTGGTGCCAATGGCGTCCAACTCGTCAATGAAGATAATGGCAGGCG
CCTTCTCCTTGGCCAAGGCGAAGGCATCGCGCACCAGCTTGGCACCATCA
CCGATGAACATTTGCACCAACTGGGGACCTGCCAGCTTGAGGAAGGTGGA
CTTTGTCTGAGCGGCGCAGGCACGGGCCAGCAATGTTTTGCCAGTTCCAG
GGGGGCCGTACAAAAGGACACCTTTGGGTGGGTGAATGCCAAGGTTTTTG
AACTTCTCCTTGTGCGTCATGGGCAGCACCACTGCCTCGATGAGCTCCTG
TATCTGCTTGTCCAAACCTCCAATGTCGGAGTACTGCTCTGTAGGTCGCT
CGTCCACTTCCATGGCTTTTACGCGGGCATCATACTCTGCCGGCAGGGTT
TCCAGGATCAAATAGGAGTCTTTGTTGACTCCGACCAGATCACCTGGCTT
CAGTTTTCTCGGCATCACCAGGGCCGATGACGG

BO05602.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG10370-PA 1287 Tbp-1-RA 397..1284 906..19 4440 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-RA 1627 CG10370-RA 509..1422 933..19 4505 99.7 Minus
Rpt3-RB 1553 CG16916-RB 955..1198 515..272 290 75.1 Minus
Rpt3-RA 1423 CG16916-RA 825..1068 515..272 290 75.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23753764..23754418 673..19 3275 100 Minus
3R 32079331 3R 23753448..23753711 933..669 1230 98.5 Minus
X 23542271 X 11126187..11126430 515..272 290 74.6 Minus
X 23542271 X 21317184..21317357 423..250 285 77.6 Minus
3R 32079331 3R 30582518..30582688 253..423 195 74.3 Plus
Blast to na_te.dros performed on 2015-02-13 02:26:41 has no hits.

BO05602.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:26:19 Download gff for BO05602.3prime
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-PA 371..1287 18..933 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:49:41 Download gff for BO05602.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10370-PA 371..1287 18..933 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:37:09 Download gff for BO05602.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 509..1422 19..933 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:16:30 Download gff for BO05602.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 509..1422 19..933 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 06:16:30 Download gff for BO05602.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 23753766..23754418 19..671 100   Minus
3R 23753448..23753708 672..933 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:37:09 Download gff for BO05602.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19579488..19580140 19..671 100   Minus
arm_3R 19579170..19579430 672..933 98 -> Minus

BO05602.5prime Sequence

875 bp (753 high quality bases) assembled on 2005-11-29

> BO05602.5prime
GAAGTTATCAGTCGACATGGCTCAGACTCTGGAGGATAAGTCAATCTGGG
AGGACGGGGAGGAGTCCCTGGGCGAGGAGGTGATGCGTATGTCCACCGAT
GAAATTGTGAGCAGGACTCGCCTGATGGACAACGAGATCAAGATCATGAA
GAGCGAAGTGATACGCATAACGCACGAGATTCAGGCGCAAAATGAGAAGA
TCAAGGACAACACCGAAAAGATCAAGGTCAACAAGACACTGCCCTACCTG
GTGTCCAATGTAATAGAGCTGCTGGATGTGGATCCACAGGAGGAGGAGGA
CGACGGCTCCGTCACCGTTCTGGACAACCAGCGAAAGGGCAAGTGCGCCG
TCATCAAAACATCCACTCGACAGGCGTATTTCCTGCCCGTCATCGGCCTG
GTTGATGCCGAGAAACTGAAGCCAGGTGATCTGGTCGGAGTCAACAAAGA
CTCCTATTTGATCCTGGAAACCCTGCCGGCAGAGTATGATGCCCGCGTAA
AAGCCATGGAAGTGGACGAGCGACCTACAGAGCAGTACTCCGACATTGGA
GGTTTGGACAAGCAGATACAGGAGCTCATCGAGGCAGTGGTGCTGCCCAT
GACGCACAAGGAGAAGTTCAAAAACCTTGGCATTCACCCACCCAAAGGTG
TCCTTTTGTACGGCCCCCCTGGAACTGGCAAAACATTGCTGGCCCGTGCC
TGCGCCGCTCAGACAAAGTCCACCTTCCTCAAGCTGGCAGGTCCCCAGTT
GGTGCAAATGTTCATCGGTGATGGTGCCAAGCTGGTGCGCGATGCCTTCG
CCTTGGCCAAGGAGAANGCGCCTGCCATTATCTTCATTGACGAGTTGGAC
GCCATTGGCACCAAGCGTTTCGATT

BO05602.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG10370-PA 1287 Tbp-1-RA 1..859 17..875 4276 99.8 Plus
CG16916-PA 1242 Rpt3-RA 743..783 804..844 136 92.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-RA 1627 CG10370-RA 136..997 14..875 4299 99.9 Plus
Rpt3-RB 1553 CG16916-RB 955..1025 804..874 224 87.3 Plus
Rpt3-RA 1423 CG16916-RA 825..895 804..874 224 87.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23753286..23753711 225..650 2130 100 Plus
3R 32079331 3R 23753764..23753993 646..875 1139 99.6 Plus
3R 32079331 3R 23753011..23753225 14..228 1075 100 Plus
X 23542271 X 11126187..11126257 804..874 224 87.3 Plus
Blast to na_te.dros performed on 2015-02-13 02:26:53 has no hits.

BO05602.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:26:20 Download gff for BO05602.5prime
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-PA 1..859 17..875 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:49:42 Download gff for BO05602.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10370-PA 1..859 17..875 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:37:12 Download gff for BO05602.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 136..997 14..875 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:17:08 Download gff for BO05602.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 136..997 14..875 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 06:17:08 Download gff for BO05602.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 23753766..23753993 648..875 99   Plus
3R 23753288..23753708 227..647 100 -> Plus
3R 23753011..23753223 14..226 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:37:12 Download gff for BO05602.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19579488..19579715 648..875 99   Plus
arm_3R 19579010..19579430 227..647 100 -> Plus
arm_3R 19578733..19578945 14..226 100 -> Plus

BO05602.complete Sequence

1318 bp (1318 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ630082

> BO05602.complete
GAAGTTATCAGTCGACATGGCTCAGACTCTGGAGGATAAGTCAATCTGGG
AGGACGGGGAGGAGTCCCTGGGCGAGGAGGTGATGCGTATGTCCACCGAT
GAAATTGTGAGCAGGACTCGCCTGATGGACAACGAGATCAAGATCATGAA
GAGCGAAGTGATACGCATAACGCACGAGATTCAGGCGCAAAATGAGAAGA
TCAAGGACAACACCGAAAAGATCAAGGTCAACAAGACACTGCCCTACCTG
GTGTCCAATGTAATAGAGCTGCTGGATGTGGATCCACAGGAGGAGGAGGA
CGACGGCTCCGTCACCGTTCTGGACAACCAGCGAAAGGGCAAGTGCGCCG
TCATCAAAACATCCACTCGACAGGCGTATTTCCTGCCCGTCATCGGCCTG
GTTGATGCCGAGAAACTGAAGCCAGGTGATCTGGTCGGAGTCAACAAAGA
CTCCTATTTGATCCTGGAAACCCTGCCGGCAGAGTATGATGCCCGCGTAA
AAGCCATGGAAGTGGACGAGCGACCTACAGAGCAGTACTCCGACATTGGA
GGTTTGGACAAGCAGATACAGGAGCTCATCGAGGCAGTGGTGCTGCCCAT
GACGCACAAGGAGAAGTTCAAAAACCTTGGCATTCACCCACCCAAAGGTG
TCCTTTTGTACGGCCCCCCTGGAACTGGCAAAACATTGCTGGCCCGTGCC
TGCGCCGCTCAGACAAAGTCCACCTTCCTCAAGCTGGCAGGTCCCCAGTT
GGTGCAAATGTTCATCGGTGATGGTGCCAAGCTGGTGCGCGATGCCTTCG
CCTTGGCCAAGGAGAAGGCGCCTGCCATTATCTTCATTGACGAGTTGGAC
GCCATTGGCACCAAGCGTTTCGATTCGGAGAAGGCCGGTGACCGTGAGGT
CCAGCGAACTATGTTGGAGCTTCTTAATCAGCTCGATGGCTTCAGTTCCA
CTGCAGATATTAAGGTGATTGCGGCCACCAATCGCGTAGACATTCTGGAT
CCTGCTCTGCTGCGCTCTGGTCGTCTGGATCGTAAGATCGAGTTCCCACA
TCCCAACGAGGAAGCCCGTGCCCGTATTATGCAGATTCACTCGCGTAAAA
TGAACGTTAGCAATGATGTGAATTTCGAGGAATTGTCCCGATCCACGGAT
GACTTCAACGGCGCCCAGTGCAAAGCCGTCTGTGTGGAAGCTGGTATGAT
CGCACTGCGTCGCTCCGCCAATTCGGTTACGCACGAAGACTTCATGGACG
CCATCATGGAAGTGCAGGCGAAGAAGAAGGCTAATCTTAACTACTACGCT
GCAAGCTTTCTAGACCAT

BO05602.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-RA 1287 CG10370-PA 1..1284 17..1300 6420 100 Plus
Rpt3-RB 1242 CG16916-PB 743..986 804..1047 290 74.6 Plus
Rpt3-RA 1242 CG16916-PA 743..986 804..1047 290 74.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-RA 1627 CG10370-RA 136..1422 14..1300 6435 100 Plus
Rpt3-RB 1553 CG16916-RB 955..1198 804..1047 290 74.6 Plus
Rpt3-RA 1423 CG16916-RA 825..1068 804..1047 290 74.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23753764..23754418 646..1300 3275 100 Plus
3R 32079331 3R 23753286..23753711 225..650 2130 100 Plus
3R 32079331 3R 23753011..23753225 14..228 1075 100 Plus
X 23542271 X 11126187..11126430 804..1047 290 74.6 Plus
X 23542271 X 21317184..21317357 896..1069 285 77.6 Plus
3R 32079331 3R 30582518..30582688 1066..896 195 74.3 Minus
Blast to na_te.dros performed on 2014-11-27 16:07:31 has no hits.

BO05602.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:30:19 Download gff for BO05602.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 1..1287 17..1301 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:56:54 Download gff for BO05602.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 134..1420 14..1300 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:49:33 Download gff for BO05602.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 139..1422 17..1302 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:30:19 Download gff for BO05602.complete
Subject Subject Range Query Range Percent Splice Strand
Tbp-1-RA 134..1420 14..1300 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:11:15 Download gff for BO05602.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt5-RA 139..1422 17..1302 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:11:15 Download gff for BO05602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23753766..23754418 648..1302 99   Plus
3R 23753288..23753708 227..647 100 -> Plus
3R 23753014..23753223 17..226 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:49:33 Download gff for BO05602.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19579488..19580140 648..1302 99   Plus
arm_3R 19579010..19579430 227..647 100 -> Plus
arm_3R 19578736..19578945 17..226 100 -> Plus

BO05602.pep Sequence

Translation from 16 to 1318

> BO05602.pep
MAQTLEDKSIWEDGEESLGEEVMRMSTDEIVSRTRLMDNEIKIMKSEVIR
ITHEIQAQNEKIKDNTEKIKVNKTLPYLVSNVIELLDVDPQEEEDDGSVT
VLDNQRKGKCAVIKTSTRQAYFLPVIGLVDAEKLKPGDLVGVNKDSYLIL
ETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIQELIEAVVLPMTHKEK
FKNLGIHPPKGVLLYGPPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFI
GDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTML
ELLNQLDGFSSTADIKVIAATNRVDILDPALLRSGRLDRKIEFPHPNEEA
RARIMQIHSRKMNVSNDVNFEELSRSTDDFNGAQCKAVCVEAGMIALRRS
ANSVTHEDFMDAIMEVQAKKKANLNYYAASFLDH

BO05602.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt5-PA 428 CG10370-PA 1..428 1..428 2156 100 Plus
Rpt2-PB 439 CG5289-PB 72..430 43..421 909 47 Plus
Rpt2-PA 439 CG5289-PA 72..430 43..421 909 47 Plus
Rpt6-PA 405 CG1489-PA 82..392 109..419 812 51.8 Plus
Rpt3-PB 413 CG16916-PB 49..394 55..409 804 44.5 Plus