Clone BO05615 Report

Search the DGRC for BO05615

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:56
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptUch-L3-RA
Protein status:BO05615.pep: validated full length
Sequenced Size:1006

Clone Sequence Records

BO05615.3prime Sequence

910 bp (881 high quality bases) assembled on 2005-12-02

> BO05615.3prime
ATGGTCTAGAAAGCTTGCGTCGGTATCCTTTTTGCGCTGCGCCTGCTCGC
GTTCTAGCGCCCTCTGCTTGGCCTTCTCGTAGATGGGCATTAGTTGTCCG
TTCTCGCCCAGAATTTTTAAGAGCTCCACGATGAAGGGCAAATAGTTGTG
CTTGCGCCGCACATTCTCCACTTTGTAGCGCTTCTTTTTCTGAATCTCGT
ACTCTATGTACGTGCGCAAGCTACTGATCTCCGCCTGTCGATCCTCCTCA
GTGTCCATAGCATTGGGCGCCGGATTAAGCAGCTTCTCAATCTGCTGTTC
ATAAATGCGCTGCCTGTCCGAGATCAGAGCCATCAGATTGAAGTGGATCT
CGCCGTCGCTGTAGCGCTGCATGCGCTTCTCAATAATCGGACGCACCACA
TCGATCCAGTTCTGCTCCGACTTGATCTCACCAAGATCAATGGGTCCCTC
CCTCAGGCCGTCCAGCTCGTACAGTCTTCCTCCGATGGGCATATAGCCGA
CAAAGTGGTACACGTCATCGTCCTTCTTCTGGTTCTTAGTGTCCAGCTCG
AAGAGTGTTGGGCGAGCAAAGGAGTTGTGCACCGTGCGAATCTGGCTAGC
GTTGCTCAAAGTTAATCCCTTGTTGTACGGATCGAAGCACTGGCAGAACT
CCTTAAAATTGGTGAGGGTCTCGCCCAATTTGATGTCCTCATGATCCAGG
TTCATCAGGAGGCTCAAGATCGCCTGGGTGGCGCATGCGTTGTTGATCAC
CTGCTTGGCAAAGAAGATGTTCTCCCGATCCAGGACCACTTTTCCAGCGG
GTTCATCCTCCTGCACCCACTTGAACAGGAAGATCAGACCATGGATGGGC
TCTAGGTTCTTGAAGGACTCGCTGTCGAGACTCCAGATCTCCTCCACCTG
TGCCCCATCG

BO05615.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG3431-PA 975 Uch-L3-RA 81..972 910..19 4460 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L5-RB 1153 CG3431-RB 199..1090 910..19 4460 100 Minus
Uch-L5-RA 1394 CG3431-RA 199..1090 910..19 4460 100 Minus
Uch-L5R-RA 1298 CG1950-RA 642..835 510..317 295 76.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9475797..9476688 19..910 4460 100 Plus
X 23542271 X 12055801..12055994 317..510 295 76.8 Plus
Blast to na_te.dros performed on 2015-02-12 00:31:59 has no hits.

BO05615.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:26:42 Download gff for BO05615.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3431-PA 81..975 15..910 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:50:14 Download gff for BO05615.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3431-PA 81..975 15..910 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:39:15 Download gff for BO05615.3prime
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 199..1100 7..910 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:05:42 Download gff for BO05615.3prime
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 199..1100 7..910 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:05:42 Download gff for BO05615.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 9475787..9476688 7..910 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:39:15 Download gff for BO05615.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9468887..9469788 7..910 99   Plus

BO05615.5prime Sequence

840 bp (808 high quality bases) assembled on 2005-11-29

> BO05615.5prime
GAAGTTATCAGTCGACATGGGCGACGGTGCTGGAAATTGGTGTCTCATTG
AATCCGATCCCGGGGTATTCACAGAGCTTATTCGCGAATTCGGATGCGAT
GGGGCACAGGTGGAGGAGATCTGGAGTCTCGACAGCGAGTCCTTCAAGAA
CCTAGAGCCCATCCATGGTCTGATCTTCCTGTTCAAGTGGGTGCAGGAGG
ATGAACCCGCTGGAAAAGTGGTCCTGGATCGGGAGAACATCTTCTTTGCC
AAGCAGGTGATCAACAACGCATGCGCCACCCAGGCGATCTTGAGCCTCCT
GATGAACCTGGATCATGAGGACATCAAATTGGGCGAGACCCTCACCAATT
TTAAGGAGTTCTGCCAGTGCTTCGATCCGTACAACAAGGGATTAACTTTG
AGCAACGCTAGCCAGATTCGCACGGTGCACAACTCCTTTGCTCGCCCAAC
ACTCTTCGAGCTGGACACTAAGAACCAGAAGAAGGACGATGACGTGTACC
ACTTTGTCGGCTATATGCCCATCGGAGGAAGACTGTACGAGCTGGACGGC
CTGAGGGAGGGACCCATTGATCTTGGTGAGATCAAGTCGGAGCAGAACTG
GATCGATGTGGTGCGTCCGATTATTGAGAAGCGCATGCAGCGCTACAGCG
ACGGCGAGATCCACTTCAATCTGATGGCTCTGATCTCGGACAGGCAGCGC
ATTTATGAACAGCAGATTGAGAAGCTGCTTAATCCGGCGCCCAATGCTAT
GGACACTGAGGAGGATCGACAGGCGGAGATCAGTAGCTTGCGCACGTACA
TAGAGTACGAGATTCAGAAAAAGAAGCGCTACAAAGTGGA

BO05615.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3431-PA 975 Uch-L3-RA 1..824 17..840 4120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L5-RB 1153 CG3431-RB 117..942 15..840 4130 100 Plus
Uch-L5-RA 1394 CG3431-RA 117..942 15..840 4130 100 Plus
Uch-L5R-RA 1298 CG1950-RA 642..835 497..690 295 76.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9475945..9476693 840..92 3745 100 Minus
3L 28110227 3L 9476771..9476849 93..15 395 100 Minus
X 23542271 X 12055801..12055994 690..497 295 76.8 Minus
Blast to na_te.dros performed on 2015-02-11 15:55:59 has no hits.

BO05615.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:26:43 Download gff for BO05615.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3431-PA 1..823 17..839 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:50:16 Download gff for BO05615.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3431-PA 1..823 17..839 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:36:35 Download gff for BO05615.5prime
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 117..941 15..839 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:35:17 Download gff for BO05615.5prime
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 117..941 15..839 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:35:17 Download gff for BO05615.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 9476772..9476849 15..92 100   Minus
3L 9475946..9476692 93..839 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:36:35 Download gff for BO05615.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9469872..9469949 15..92 100   Minus
arm_3L 9469046..9469792 93..839 100 <- Minus

BO05615.complete Sequence

1006 bp (1006 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ630093

> BO05615.complete
GAAGTTATCAGTCGACATGGGCGACGGTGCTGGAAATTGGTGTCTCATTG
AATCCGATCCCGGGGTATTCACAGAGCTTATTCGCGAATTCGGATGCGAT
GGGGCACAGGTGGAGGAGATCTGGAGTCTCGACAGCGAGTCCTTCAAGAA
CCTAGAGCCCATCCATGGTCTGATCTTCCTGTTCAAGTGGGTGCAGGAGG
ATGAACCCGCTGGAAAAGTGGTCCTGGATCGGGAGAACATCTTCTTTGCC
AAGCAGGTGATCAACAACGCATGCGCCACCCAGGCGATCTTGAGCCTCCT
GATGAACCTGGATCATGAGGACATCAAATTGGGCGAGACCCTCACCAATT
TTAAGGAGTTCTGCCAGTGCTTCGATCCGTACAACAAGGGATTAACTTTG
AGCAACGCTAGCCAGATTCGCACGGTGCACAACTCCTTTGCTCGCCCAAC
ACTCTTCGAGCTGGACACTAAGAACCAGAAGAAGGACGATGACGTGTACC
ACTTTGTCGGCTATATGCCCATCGGAGGAAGACTGTACGAGCTGGACGGC
CTGAGGGAGGGACCCATTGATCTTGGTGAGATCAAGTCGGAGCAGAACTG
GATCGATGTGGTGCGTCCGATTATTGAGAAGCGCATGCAGCGCTACAGCG
ACGGCGAGATCCACTTCAATCTGATGGCTCTGATCTCGGACAGGCAGCGC
ATTTATGAACAGCAGATTGAGAAGCTGCTTAATCCGGCGCCCAATGCTAT
GGACACTGAGGAGGATCGACAGGCGGAGATCAGTAGCTTGCGCACGTACA
TAGAGTACGAGATTCAGAAAAAGAAGCGCTACAAAGTGGAGAATGTGCGG
CGCAAGCACAACTATTTGCCCTTCATCGTGGAGCTCTTAAAAATTCTGGG
CGAGAACGGACAACTAATGCCCATCTACGAGAAGGCCAAGCAGAGGGCGC
TAGAACGCGAGCAGGCGCAGCGCAAAAAGGATACCGACGCAAGCTTTCTA
GACCAT

BO05615.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L5-RB 975 CG3431-PB 1..972 17..988 4860 100 Plus
Uch-L5-RA 975 CG3431-PA 1..972 17..988 4860 100 Plus
Uch-L5R-RA 1023 CG1950-PA 529..722 497..690 295 76.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L5-RB 1153 CG3431-RB 117..1090 15..988 4870 100 Plus
Uch-L5-RA 1394 CG3431-RA 117..1090 15..988 4870 100 Plus
Uch-L5R-RA 1298 CG1950-RA 642..835 497..690 295 76.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9475797..9476693 988..92 4485 100 Minus
3L 28110227 3L 9476771..9476849 93..15 395 100 Minus
X 23542271 X 12055801..12055994 690..497 295 76.8 Minus
Blast to na_te.dros performed on 2014-11-27 07:05:49 has no hits.

BO05615.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:30:10 Download gff for BO05615.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 1..975 17..992 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:56:41 Download gff for BO05615.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 125..1108 15..1000 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:01 Download gff for BO05615.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 119..1090 17..990 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:30:10 Download gff for BO05615.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L3-RA 125..1108 15..1000 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:02:51 Download gff for BO05615.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-L5-RA 119..1090 17..990 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:02:51 Download gff for BO05615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9476772..9476847 17..92 100   Minus
3L 9475795..9476692 93..990 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:01 Download gff for BO05615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9469872..9469947 17..92 100   Minus
arm_3L 9468895..9469792 93..990 99 <- Minus

BO05615.pep Sequence

Translation from 16 to 1006

> BO05615.pep
MGDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIH
GLIFLFKWVQEDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLDH
EDIKLGETLTNFKEFCQCFDPYNKGLTLSNASQIRTVHNSFARPTLFELD
TKNQKKDDDVYHFVGYMPIGGRLYELDGLREGPIDLGEIKSEQNWIDVVR
PIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNPAPNAMDTEED
RQAEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLKILGENGQL
MPIYEKAKQRALEREQAQRKKDTDASFLDH

BO05615.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-L5-PB 324 CG3431-PB 1..324 1..324 1701 100 Plus
Uch-L5-PA 324 CG3431-PA 1..324 1..324 1701 100 Plus
Uch-L5R-PA 340 CG1950-PA 22..325 5..311 1048 63.8 Plus
calypso-PA 471 CG8445-PA 39..393 1..300 444 31.9 Plus
calypso-PB 471 CG8445-PB 39..393 1..300 444 31.9 Plus