Clone BO05625 Report

Search the DGRC for BO05625

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:56
Well:25
Vector:pDNR-Dual
Associated Gene/Transcriptmorgue-RA
Protein status:BO05625.pep: validated full length
Sequenced Size:1507

Clone Sequence Records

BO05625.3prime Sequence

909 bp (897 high quality bases) assembled on 2005-12-02

> BO05625.3prime
ATGGTCTAGAAAGCTTGCGCGCGGTGCAATTAGCTCGTACATGGCGTACT
TCCATGTCCACGCGCGCACCAGTTGCTCGAACCTTTCGCGCTCGTGCTCA
TAGATGTATCCAAGTTCAGGCTCCATGCAGACTTCGGTATACGGATCGGT
CAGCAGGCTCTGCACAGAAAGCAGCACCTTGGCCACGTTCAGCGCCAGAG
ACCAGTTGTGCTGCTGGAAGATGTCGATGCCCACGTCCCCATGCCGCGAA
ACATTCGGATGCAGGATTTTGGTGAGGAAACGTACTGTGGGCGGCGTCAT
CGGATATCGCTCCGGGAAGTATATGAACAGGAAGAACTTGCCGCCTTCGT
AGGGACTGCCCGGTGGCCCCAGAATTGTCGCCTGCCAGTAGTTGTTTTGC
CGATCCAACGGTATGGCCGATATGCCCTCAGATTCGTAGCTGTTCAGCAG
ATTGGCTTCACCGCGCAGAAAGTTGTTGCGCATTACATTGCCCGGCTCCC
GATCGCCCAGCTGTGGATCTGCCTCCTGTGCATCCTGACCCCGACCGCCC
ATCTCAATCAGGCAAGTGCGACAGAAGCAGGAAGACATCAGTGCCCCGTA
CAGCCGATACCAGTTTGGATTGTCTGCCAAACTGTCGAACAGCGGCCAGC
GCTGCTTGATATACGCCTTCCACATGCTCTGGGCCGTGTTTTTCCCGACA
ATGTCGTGCCATTGCTTGCAAACTTCACTAGCCATCCACAGCGACATGTC
GTCCAAATAGGCAAATATTTTCAGCATCACCTCGACGGGTATTATGTTGA
CAATGTTTCTGCTGCTGCCACTTGCTCCGCTTCCGCTGGCGGCGTTGTAT
TCATGCACTCGCGCCCTTCCATCGGCCAGCTCATGCATGTAATGGGGCAG
AGCAAGGGA

BO05625.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15437-PA 1476 morgue-RA 589..1473 903..19 4425 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 15:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-RA 1749 CG15437-RA 655..1546 909..19 4435 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4443073..4443957 19..903 4425 100 Plus
Blast to na_te.dros performed 2015-02-12 15:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 11081..11134 855..802 108 66.7 Minus

BO05625.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:26:59 Download gff for BO05625.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15437-PA 583..1476 18..908 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:50:39 Download gff for BO05625.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15437-PA 583..1476 18..908 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:10:21 Download gff for BO05625.3prime
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 656..1546 19..908 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:25:57 Download gff for BO05625.3prime
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 656..1546 19..908 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:25:57 Download gff for BO05625.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 4443073..4443963 19..908 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:10:21 Download gff for BO05625.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4443073..4443963 19..908 99   Plus

BO05625.5prime Sequence

881 bp (880 high quality bases) assembled on 2005-11-29

> BO05625.5prime
GAAGTTATCAGTCGACATGACTAGCTGCGTGCCAGCGCATCAGCAAAAGG
ACCAGGAGCAGTTGCTAAAGGAACTGGCCAGCAGTGGCGACGAGATGGAC
GACCCGGACGATCCGGACCAGGAACACCACCAGCTGGTAGAGCCGACCTT
CTCTTTTTCGAATAGTAACACCTGCTGGGTGTGCAACGGCTACTATGGGC
CCAACTTCGGGGAGCCGTTGTGCGGCGCCTGCCACGCCTTCCTGTACAAC
GCACAGCGGGCGGAGGAGCTGCTCACGGAGCTTTCCGATGACGAGGATTC
TGGGAACGACGAGCCGCCGTTCAAGGACAAGCAGGAAGACGAGGAGACCG
AAAACGACGTAGACATCATGGGCTTTGAGGATCTGGAGGACCCCCAACCG
GCAGCCGTGCCACAACATCCAAATCCGCAGCCACCAATGGAGCCACAGGA
TCAACAGCCAGCCCAACCAGTTATAGATCTGCCACAGCCGGTGCCGGAGG
CTGCGGCACCACGACGCGAGTCTCCGGAGCGCGACTTTGAGCACGAGAGA
GCCATTAATCCCTTCCTGCTGCCCATTAAGCGTCCGCGGGCCACGGCTCC
CTTGGCTCTGCCCCATTACATGCATGAGCTGGCCGATGGAAGGGCGCGAG
TGCATGAATACAACGCCGCCAGCGGAAGCGGAGCAAGTGGCAGCAGCAGA
AACATTGTCAACATAATACCCGTCGAGGTGATGCTGAAAATATTTGCCTA
TTTGGACGACATGTCGCTGTGGATGGCTAGTGAAGTTTGCAAGCAATGGC
ACGACATTGTCGGGAAAACACGGCCCAGAGCATGTGGAAGGCGTATATCA
NGCAGCGCTGGCCGCTGTTCGACAGTTTGGC

BO05625.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15437-PA 1476 morgue-RA 1..802 17..818 4010 100 Plus
CG15437-PA 1476 morgue-RA 800..866 815..881 316 98.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-RA 1749 CG15437-RA 74..939 17..881 4294 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4443680..4444402 881..160 3554 99.7 Minus
2L 23513712 2L 4444464..4444607 160..17 720 100 Minus
Blast to na_te.dros performed 2015-02-12 10:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 11081..11134 653..706 108 66.7 Plus

BO05625.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:27:00 Download gff for BO05625.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15437-PA 1..866 17..881 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:50:41 Download gff for BO05625.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15437-PA 1..866 17..881 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:56:12 Download gff for BO05625.5prime
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 66..939 8..881 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:08:21 Download gff for BO05625.5prime
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 66..939 8..881 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:08:21 Download gff for BO05625.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 4444464..4444615 8..160 97   Minus
2L 4443680..4444401 161..881 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:56:12 Download gff for BO05625.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4444464..4444615 8..160 97   Minus
arm_2L 4443680..4444401 161..881 99 <- Minus

BO05625.complete Sequence

1507 bp (1507 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ630097

> BO05625.complete
GAAGTTATCAGTCGACATGACTAGCTGCGTGCCAGCGCATCAGCAAAAGG
ACCAGGAGCAGTTGCTAAAGGAACTGGCCAGCAGTGGCGACGAGATGGAC
GACCCGGACGATCCGGACCAGGAACACCACCAGCTGGTAGAGCCGACCTT
CTCTTTTTCGAATAGTAACACCTGCTGGGTGTGCAACGGCTACTATGGGC
CCAACTTCGGGGAGCCGTTGTGCGGCGCCTGCCACGCCTTCCTGTACAAC
GCACAGCGGGCGGAGGAGCTGCTCACGGAGCTTTCCGATGACGAGGATTC
TGGGAACGACGAGCCGCCGTTCAAGGACAAGCAGGAAGACGAGGAGACCG
AAAACGACGTAGACATCATGGGCTTTGAGGATCTGGAGGACCCCCAACCG
GCAGCCGTGCCACAACATCCAAATCCGCAGCCACCAATGGAGCCACAGGA
TCAACAGCCAGCCCAACCAGTTATAGATCTGCCACAGCCGGTGCCGGAGG
CTGCGGCACCACGACGCGAGTCTCCGGAGCGCGACTTTGAGCACGAGAGA
GCCATTAATCCCTTCCTGCTGCCCATTAAGCGTCCGCGGGCCACGGCTCC
CTTGGCTCTGCCCCATTACATGCATGAGCTGGCCGATGGAAGGGCGCGAG
TGCATGAATACAACGCCGCCAGCGGAAGCGGAGCAAGTGGCAGCAGCAGA
AACATTGTCAACATAATACCCGTCGAGGTGATGCTGAAAATATTTGCCTA
TTTGGACGACATGTCGCTGTGGATGGCTAGTGAAGTTTGCAAGCAATGGC
ACGACATTGTCGGGAAAAACACGGCCCAGAGCATGTGGAAGGCGTATATC
AAGCAGCGCTGGCCGCTGTTCGACAGTTTGGCAGACAATCCAAACTGGTA
TCGGCTGTACGGGGCACTGATGTCTTCCTGCTTCTGTCGCACTTGCCTGA
TTGAGATGGGCGGTCGGGGTCAGGATGCACAGGAGGCAGATCCACAGCTG
GGCGATCGGGAGCCGGGCAATGTAATGCGCAACAACTTTCTGCGCGGTGA
AGCCAATCTGCTGAACAGCTACGAATCTGAGGGCATATCGGCCATACCGT
TGGATCGGCAAAACAACTACTGGCAGGCGACAATTCTGGGGCCACCGGGC
AGTCCCTACGAAGGCGGCAAGTTCTTCCTGTTCATATACTTCCCGGAGCG
ATATCCGATGACGCCGCCCACAGTACGTTTCCTCACCAAAATCCTGCATC
CGAATGTTTCGCGGCATGGGGACGTGGGCATCGACATCTTCCAGCAGCAC
AACTGGTCTCTGGCGCTGAACGTGGCCAAGGTGCTGCTTTCTGTGCAGAG
CCTGCTGACCGATCCGTATACCGAAGTCTGCATGGAGCCTGAACTTGGAT
ACATCTATGAGCACGAGCGCGAAAGGTTCGAGCAACTGGTGCGCGCGTGG
ACATGGAAGTACGCCATGTACGAGCTAATTGCACCGCGCGCAAGCTTTCT
AGACCAT

BO05625.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-RA 1476 CG15437-PA 1..1473 17..1489 7365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-RA 1749 CG15437-RA 74..1546 17..1489 7365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4443073..4444402 1489..160 6650 100 Minus
2L 23513712 2L 4444464..4444607 160..17 720 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:43:03 has no hits.

BO05625.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:30:14 Download gff for BO05625.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 1..1476 17..1490 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:56:47 Download gff for BO05625.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 63..1543 8..1489 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:58:08 Download gff for BO05625.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 74..1546 17..1491 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:30:14 Download gff for BO05625.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 63..1543 8..1489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:25:22 Download gff for BO05625.complete
Subject Subject Range Query Range Percent Splice Strand
morgue-RA 74..1546 17..1491 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:25:22 Download gff for BO05625.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4444464..4444607 17..160 100   Minus
2L 4443071..4444401 161..1491 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:58:08 Download gff for BO05625.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4444464..4444607 17..160 100   Minus
arm_2L 4443071..4444401 161..1491 99 <- Minus

BO05625.pep Sequence

Translation from 16 to 1507

> BO05625.pep
MTSCVPAHQQKDQEQLLKELASSGDEMDDPDDPDQEHHQLVEPTFSFSNS
NTCWVCNGYYGPNFGEPLCGACHAFLYNAQRAEELLTELSDDEDSGNDEP
PFKDKQEDEETENDVDIMGFEDLEDPQPAAVPQHPNPQPPMEPQDQQPAQ
PVIDLPQPVPEAAAPRRESPERDFEHERAINPFLLPIKRPRATAPLALPH
YMHELADGRARVHEYNAASGSGASGSSRNIVNIIPVEVMLKIFAYLDDMS
LWMASEVCKQWHDIVGKNTAQSMWKAYIKQRWPLFDSLADNPNWYRLYGA
LMSSCFCRTCLIEMGGRGQDAQEADPQLGDREPGNVMRNNFLRGEANLLN
SYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTP
PTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDP
YTEVCMEPELGYIYEHERERFEQLVRAWTWKYAMYELIAPRASFLDH

BO05625.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
morgue-PA 491 CG15437-PA 1..491 1..491 2680 100 Plus
eff-PC 147 CG7425-PC 22..147 358..484 336 50.4 Plus
eff-PB 147 CG7425-PB 22..147 358..484 336 50.4 Plus
eff-PA 147 CG7425-PA 22..147 358..484 336 50.4 Plus
CG3473-PB 151 CG3473-PB 22..149 356..484 259 42.6 Plus