Clone BO05629 Report

Search the DGRC for BO05629

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:56
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptVps4-RA
Protein status:BO05629.pep: validated full length
Sequenced Size:1360

Clone Sequence Records

BO05629.3prime Sequence

882 bp (846 high quality bases) assembled on 2005-12-02

> BO05629.3prime
ATGGTCTAGAAAGCTTGCGCCCTCCTGCCCAAAGTCCTCTGTGAATTTGC
GCAGCTTCTTCAGATCGTCTTCGTTGACGGTCGGTTTCGTGCGGGACAAG
GACTTCAGCATGTCGCGCATGGTCACGGGCGGTTCGAAGAGCTTGTCGCT
GGGCACATCCATCCAGTTCATCTCGACGGCGCCCTGGTCGCCAGGTGAGC
ACGGAACCAGCAAATCGTTGACAATCTCCTCGTGGTTGGTGGGACTCGGA
CCGGATACCCGCTTGAAATGCGTGGCGGTCTGCACTTTCCTCACGGGTTC
CATCAGCGCATCGCGCACAACGATTGATATATCCGCGCCAGAGTAGCCCT
CGGTTTTGCCGGCCAACTCCTTGAGATCCTGCTCGGTGAGCACGTGCGTG
GTGTTGCCCAGATGGATCTTGAACATGACGAGGCGGGCATGCGCCTCCGG
CAGCGGAATGTAGATGCGCTTCTCGAATCGACGGCGAATGGCCGAGTCGA
GGACCCACGGTATGTTTGTGGCGCCGAGAACGAGAATGCCATCGGTGTCA
TTGCCCACGCCCTGCATCTGCACCAGAAACTCGGTCTTGATGCGTCGCAC
GCTGTCGTTCTCGTTGTCCGATCTCGCCGAGCACATCGAATCGATCTCGT
CAATGAAGATAATGGAGGGCTTGTGCTGGCGGGCCAGTTCGAAGAGATTC
TTGACCAGCTTCTCGGACTCGCCCAGCCACTTGGACATCAGATCCGAACT
GGACACCGAGAAGAATGTGGAGCGATTGGCCTCGGTGGCGACGGCCTTGG
CCAGATAGGATTTACCGGTACCGGGCGGGCCGAACAGCAGGATGCCCTTC
CACGGAATCCGCTTGCCAGTGAAGAGCTGCGG

BO05629.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG6842-PA 1329 CG6842-RA 463..1326 882..19 4320 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 11:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-RB 2411 CG6842-RB 627..1490 882..19 4320 100 Minus
Vps4-RA 2031 CG6842-RA 627..1490 882..19 4320 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 11:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17909134..17909669 882..347 2680 100 Minus
X 23542271 X 17909780..17910009 347..118 1150 100 Minus
X 23542271 X 17910077..17910176 118..19 500 100 Minus
Blast to na_te.dros performed on 2015-02-13 11:49:04 has no hits.

BO05629.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:27:07 Download gff for BO05629.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6842-PA 463..1329 18..882 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:50:51 Download gff for BO05629.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6842-PA 463..1329 18..882 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:45:29 Download gff for BO05629.3prime
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 627..1490 19..882 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:14:41 Download gff for BO05629.3prime
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 627..1490 19..882 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:14:41 Download gff for BO05629.3prime
Subject Subject Range Query Range Percent Splice Strand
X 17910078..17910176 19..117 100   Minus
X 17909781..17910009 118..346 100 -> Minus
X 17909134..17909669 347..882 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:45:29 Download gff for BO05629.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17804111..17804209 19..117 100   Minus
arm_X 17803814..17804042 118..346 100 -> Minus
arm_X 17803167..17803702 347..882 100 -> Minus

BO05629.5prime Sequence

803 bp (801 high quality bases) assembled on 2005-11-29

> BO05629.5prime
GAAGTTATCAGTCGACATGGCAGCCGGTACCACACTACAGAAGGCCATCG
ATCTGGTGACCAAGGCCACCGAGGAGGATCGAAATAAGAACTACGCGGAG
GCACTGCGTCTGTATGAGCACGGGGTGGAGTACTTCCTGCACACCATCAA
ATATGAGGCACAGGGCGAGAAGGCCAAGGACTCGATACGGGCCAAGTGCC
TGCAGTATTTGGACCGGGCCGAGAAGCTAAAGGAGTACCTGAAGAAGGGC
AAAAAGAAACCGATCAAGGAGGGTGGTGAGTCCAGCGCCAAGGACGACAA
GGACAAAAAGAGCGACAGCGATGACGAGGACGGCGACGATCCCGAGAAGA
AGAAGCTGCAGAGCAAGCTGGAGGACGCCATTGTCATAGAGAAGCCAAAG
GTTCAGTGGTCCGATGTCGCTGGCCTGGATGCCGCCAAGGAGGCGCTGAA
GGAGGCCGTTATCCTGCCGATTAAATTCCCGCAGCTCTTCACTGGCAAGC
GGATTCCGTGGAAGGGCATCCTGCTGTTCGGCCCGCCCGGTACCGGTAAA
TCCTATCTGGCCAAGGCCGTCGCCACCGAGGCCAATCGCTCCACATTCTT
CTCGGTGTCCAGTTCGGATCTGATGTCCAAGTGGCTGGGCGAGTCCGAGA
AGCTGGTCAAGAATCTCTTCGAACTGGCCCGCCAGCACAAGCCCTCCATT
ATCTTCATTGACGAGATCGATTCGATGTGCTCGGCGAGATCGGACAACGA
GAACGACAGCGTGCGACGCATCAAGACCGAGTTTCTGGTGCAGATGCAGG
GCG

BO05629.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6842-PA 1329 CG6842-RA 1..787 17..803 3935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-RB 2411 CG6842-RB 164..951 16..803 3940 100 Plus
Vps4-RA 2031 CG6842-RA 164..951 16..803 3940 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17908808..17909458 153..803 3255 100 Plus
X 23542271 X 17908577..17908713 16..152 685 100 Plus
Blast to na_te.dros performed on 2015-02-11 15:56:06 has no hits.

BO05629.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:27:08 Download gff for BO05629.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6842-PA 1..787 17..803 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:50:52 Download gff for BO05629.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6842-PA 1..787 17..803 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:36:38 Download gff for BO05629.5prime
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 155..951 7..803 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:35:19 Download gff for BO05629.5prime
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 155..951 7..803 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:35:19 Download gff for BO05629.5prime
Subject Subject Range Query Range Percent Splice Strand
X 17908808..17909458 153..803 100   Plus
X 17908568..17908713 5..152 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:36:38 Download gff for BO05629.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17802841..17803491 153..803 100   Plus
arm_X 17802601..17802746 5..152 96 -> Plus

BO05629.complete Sequence

1360 bp (1360 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ630101

> BO05629.complete
GAAGTTATCAGTCGACATGGCAGCCGGTACCACACTACAGAAGGCCATCG
ATCTGGTGACCAAGGCCACCGAGGAGGATCGAAATAAGAACTACGCGGAG
GCACTGCGTCTGTATGAGCACGGGGTGGAGTACTTCCTGCACACCATCAA
ATATGAGGCACAGGGCGAGAAGGCCAAGGACTCGATACGGGCCAAGTGCC
TGCAGTATTTGGACCGGGCCGAGAAGCTAAAGGAGTACCTGAAGAAGGGC
AAAAAGAAACCGATCAAGGAGGGTGGTGAGTCCAGCGCCAAGGACGACAA
GGACAAAAAGAGCGACAGCGATGACGAGGACGGCGACGATCCCGAGAAGA
AGAAGCTGCAGAGCAAGCTGGAGGACGCCATTGTCATAGAGAAGCCAAAG
GTTCAGTGGTCCGATGTCGCTGGCCTGGATGCCGCCAAGGAGGCGCTGAA
GGAGGCCGTTATCCTGCCGATTAAATTCCCGCAGCTCTTCACTGGCAAGC
GGATTCCGTGGAAGGGCATCCTGCTGTTCGGCCCGCCCGGTACCGGTAAA
TCCTATCTGGCCAAGGCCGTCGCCACCGAGGCCAATCGCTCCACATTCTT
CTCGGTGTCCAGTTCGGATCTGATGTCCAAGTGGCTGGGCGAGTCCGAGA
AGCTGGTCAAGAATCTCTTCGAACTGGCCCGCCAGCACAAGCCCTCCATT
ATCTTCATTGACGAGATCGATTCGATGTGCTCGGCGAGATCGGACAACGA
GAACGACAGCGTGCGACGCATCAAGACCGAGTTTCTGGTGCAGATGCAGG
GCGTGGGCAATGACACCGATGGCATTCTCGTTCTCGGCGCCACAAACATA
CCGTGGGTCCTCGACTCGGCCATTCGCCGTCGATTCGAGAAGCGCATCTA
CATTCCGCTGCCGGAGGCGCATGCCCGCCTCGTCATGTTCAAGATCCATC
TGGGCAACACCACGCACGTGCTCACCGAGCAGGATCTCAAGGAGTTGGCC
GGCAAAACCGAGGGCTACTCTGGCGCGGATATATCAATCGTTGTGCGCGA
TGCGCTGATGGAACCCGTGAGGAAAGTGCAGACCGCCACGCATTTCAAGC
GGGTATCCGGTCCGAGTCCCACCAACCACGAGGAGATTGTCAACGATTTG
CTGGTTCCGTGCTCACCTGGCGACCAGGGCGCCGTCGAGATGAACTGGAT
GGATGTGCCCAGCGACAAGCTCTTCGAACCGCCCGTGACCATGCGCGACA
TGCTGAAGTCCTTGTCCCGCACGAAACCGACCGTCAACGAAGACGATCTG
AAGAAGCTGCGCAAATTCACAGAGGACTTTGGGCAGGAGGGCGCAAGCTT
TCTAGACCAT

BO05629.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-RB 1329 CG6842-PB 1..1326 17..1342 6630 100 Plus
Vps4-RA 1329 CG6842-PA 1..1326 17..1342 6630 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-RB 2411 CG6842-RB 164..1490 16..1342 6635 100 Plus
Vps4-RA 2031 CG6842-RA 164..1490 16..1342 6635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17908808..17909669 153..1014 4310 100 Plus
X 23542271 X 17909780..17910009 1014..1243 1150 100 Plus
X 23542271 X 17908577..17908713 16..152 685 100 Plus
X 23542271 X 17910077..17910176 1243..1342 500 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:25:31 has no hits.

BO05629.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:30:16 Download gff for BO05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG6842-RA 1..1329 17..1343 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:56:50 Download gff for BO05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG6842-RA 160..1495 7..1342 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:18:21 Download gff for BO05629.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 165..1490 17..1344 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:30:16 Download gff for BO05629.complete
Subject Subject Range Query Range Percent Splice Strand
CG6842-RA 160..1495 7..1342 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:30 Download gff for BO05629.complete
Subject Subject Range Query Range Percent Splice Strand
Vps4-RA 165..1490 17..1344 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:21:30 Download gff for BO05629.complete
Subject Subject Range Query Range Percent Splice Strand
X 17910078..17910176 1244..1344 98   Plus
X 17909781..17910009 1015..1243 100 -> Plus
X 17908808..17909669 153..1014 100 -> Plus
X 17908578..17908713 17..152 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:18:21 Download gff for BO05629.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17804111..17804209 1244..1344 98   Plus
arm_X 17803814..17804042 1015..1243 100 -> Plus
arm_X 17802841..17803702 153..1014 100 -> Plus
arm_X 17802611..17802746 17..152 100 -> Plus

BO05629.pep Sequence

Translation from 16 to 1360

> BO05629.pep
MAAGTTLQKAIDLVTKATEEDRNKNYAEALRLYEHGVEYFLHTIKYEAQG
EKAKDSIRAKCLQYLDRAEKLKEYLKKGKKKPIKEGGESSAKDDKDKKSD
SDDEDGDDPEKKKLQSKLEDAIVIEKPKVQWSDVAGLDAAKEALKEAVIL
PIKFPQLFTGKRIPWKGILLFGPPGTGKSYLAKAVATEANRSTFFSVSSS
DLMSKWLGESEKLVKNLFELARQHKPSIIFIDEIDSMCSARSDNENDSVR
RIKTEFLVQMQGVGNDTDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPE
AHARLVMFKIHLGNTTHVLTEQDLKELAGKTEGYSGADISIVVRDALMEP
VRKVQTATHFKRVSGPSPTNHEEIVNDLLVPCSPGDQGAVEMNWMDVPSD
KLFEPPVTMRDMLKSLSRTKPTVNEDDLKKLRKFTEDFGQEGASFLDH

BO05629.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Vps4-PB 442 CG6842-PB 1..442 1..442 2273 100 Plus
Vps4-PA 442 CG6842-PA 1..442 1..442 2273 100 Plus
Kat60-PA 572 CG10229-PA 244..570 86..439 640 41.6 Plus
Kat60-PB 605 CG10229-PB 277..603 86..439 640 41.6 Plus
kat-60L1-PF 605 CG1193-PF 235..603 67..439 627 39 Plus