Clone BO05722 Report

Search the DGRC for BO05722

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:57
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptUch-RA
Protein status:BO05722.pep: validated full length
Sequenced Size:715

Clone Sequence Records

BO05722.3prime Sequence

713 bp (712 high quality bases) assembled on 2005-12-02

> BO05722.3prime
ATGGTCTAGAAAGCTTGCTTGTTGTGCCGCGGTCAAGGCCAAAACGGTGA
AGCGCACTTCGTTGGGATCGCGAGCCATGAACTCCTTGCAGACCTTGGCC
GCATCCTTCACAAAAGTCTCCTCCGAAGTCGGTCCGTGCTTGATCGGGAA
GGACTTGCGGCCATCCAGCTCGTACAGAGTACCCTCCTTGTTCACCAGTG
CGATGAAGTGGTGGATCACCTTCTCATGATTGGCGGCATTCGTCTGGCCC
TCTTGAGCCAAGGCCTCATGATCGGCGGTGAACTTCTCGTCTTTTTCGAG
GGCCCGTCCGCGTTCCTCCGGGGACAAGGAAGCTGTCTTCTCCAGGAAGT
CCTTCAGTACTCCGCGGTCAATGTCCACTTCTTTGTTGTTGGCCACGCTG
TGGATCAGGGCGACGGTTCCACAGGCGTTGTGGGTGAACTGGCGCATGTA
GAAGAGATCCTCGGGATGCTGCTCCTCCACCTCCTTAATCCGATCGTGCT
CCTCGGCGCGGTGCTTCTCATAGGTTTCGCTGCACGGGAAGAGCAAAATG
AACGCCTTTACGGGACGCGGAATCCATTCCAAGGTGTCATCTTCCAATCC
AATGACGTCAGTTACCGACCAGGCTGGCGACACGCCCAGTTTATGTATGT
ACTTGGTCAAAACCTCGGGATTAGATTCAAGTGGCGTCCAGGTTAACATG
TCGACTGATAACT

BO05722.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4265-PA 684 Uch-RA 1..681 699..19 3405 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-RB 1044 CG4265-RB 129..809 699..19 3405 100 Minus
Uch-RA 1196 CG4265-RA 281..961 699..19 3405 100 Minus
Uch-RC 1035 CG4265-RC 129..800 699..19 3260 98.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2212973..2213333 19..379 1805 100 Plus
2L 23513712 2L 2213415..2213557 380..522 715 100 Plus
2L 23513712 2L 2213616..2213758 523..665 715 100 Plus
2L 23513712 2L 2213894..2213931 662..699 190 100 Plus
Blast to na_te.dros performed on 2015-02-12 06:45:39 has no hits.

BO05722.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:29:34 Download gff for BO05722.3prime
Subject Subject Range Query Range Percent Splice Strand
Uch-PA 1..684 18..699 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:54:21 Download gff for BO05722.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4265-PA 1..684 18..699 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:30:10 Download gff for BO05722.3prime
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 281..961 19..699 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:17:11 Download gff for BO05722.3prime
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 281..961 19..699 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:17:11 Download gff for BO05722.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 2213896..2213931 664..699 100   Plus
2L 2213616..2213756 523..663 100 <- Plus
2L 2213415..2213557 380..522 100 <- Plus
2L 2212973..2213333 19..379 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:30:10 Download gff for BO05722.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2213896..2213931 664..699 100   Plus
arm_2L 2213616..2213756 523..663 100 <- Plus
arm_2L 2213415..2213557 380..522 100 <- Plus
arm_2L 2212973..2213333 19..379 100 <- Plus

BO05722.5prime Sequence

713 bp (712 high quality bases) assembled on 2005-11-29

> BO05722.5prime
GAAGTTATCAGTCGACATGTTAACCTGGACGCCACTTGAATCTAATCCCG
AGGTTTTGACCAAGTACATACATAAACTGGGCGTGTCGCCAGCCTGGTCG
GTAACTGACGTCATTGGATTGGAAGATGACACCTTGGAATGGATTCCGCG
TCCCGTAAAGGCGTTCATTTTGCTCTTCCCGTGCAGCGAAACCTATGAGA
AGCACCGCGCCGAGGAGCACGATCGGATTAAGGAGGTGGAGGAGCAGCAT
CCCGAGGATCTCTTCTACATGCGCCAGTTCACCCACAACGCCTGTGGAAC
CGTCGCCCTGATCCACAGCGTGGCCAACAACAAAGAAGTGGACATTGACC
GCGGAGTACTGAAGGACTTCCTGGAGAAGACAGCTTCCTTGTCCCCGGAG
GAACGCGGACGGGCCCTCGAAAAAGACGAGAAGTTCACCGCCGATCATGA
GGCCTTGGCTCAAGAGGGCCAGACGAATGCCGCCAATCATGAGAAGGTGA
TCCACCACTTCATCGCACTGGTGAACAAGGAGGGTACTCTGTACGAGCTG
GATGGCCGCAAGTCCTTCCCGATCAAGCACGGACCGACTTCGGAGGAGAC
TTTTGTGAAGGATGCGGCCAAGGTCTGCAAGGAGTTCATGGCTCGCGATC
CCAACGAAGTGCGCTTCACCGTTTTGGCCTTGACCGCGGCACAACAAGCA
AGCTTTCTAGACC

BO05722.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG4265-PA 684 Uch-RA 1..681 17..697 3405 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-RB 1044 CG4265-RB 129..809 17..697 3405 100 Plus
Uch-RA 1196 CG4265-RA 281..961 17..697 3405 100 Plus
Uch-RC 1035 CG4265-RC 129..800 17..697 3260 98.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2212973..2213333 697..337 1805 100 Minus
2L 23513712 2L 2213415..2213557 336..194 715 100 Minus
2L 23513712 2L 2213616..2213758 193..51 715 100 Minus
2L 23513712 2L 2213894..2213931 54..17 190 100 Minus
Blast to na_te.dros performed on 2015-02-12 06:45:49 has no hits.

BO05722.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:29:35 Download gff for BO05722.5prime
Subject Subject Range Query Range Percent Splice Strand
Uch-PA 1..684 17..698 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:54:22 Download gff for BO05722.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4265-PA 1..684 17..698 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:30:12 Download gff for BO05722.5prime
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 281..961 17..697 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:17:48 Download gff for BO05722.5prime
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 281..961 17..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:17:48 Download gff for BO05722.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 2213896..2213931 17..52 100   Minus
2L 2213616..2213756 53..193 100 <- Minus
2L 2213415..2213557 194..336 100 <- Minus
2L 2212973..2213333 337..697 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:30:12 Download gff for BO05722.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2213896..2213931 17..52 100   Minus
arm_2L 2213616..2213756 53..193 100 <- Minus
arm_2L 2213415..2213557 194..336 100 <- Minus
arm_2L 2212973..2213333 337..697 100 <- Minus

BO05722.complete Sequence

715 bp (715 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ630147

> BO05722.complete
GAAGTTATCAGTCGACATGTTAACCTGGACGCCACTTGAATCTAATCCCG
AGGTTTTGACCAAGTACATACATAAACTGGGCGTGTCGCCAGCCTGGTCG
GTAACTGACGTCATTGGATTGGAAGATGACACCTTGGAATGGATTCCGCG
TCCCGTAAAGGCGTTCATTTTGCTCTTCCCGTGCAGCGAAACCTATGAGA
AGCACCGCGCCGAGGAGCACGATCGGATTAAGGAGGTGGAGGAGCAGCAT
CCCGAGGATCTCTTCTACATGCGCCAGTTCACCCACAACGCCTGTGGAAC
CGTCGCCCTGATCCACAGCGTGGCCAACAACAAAGAAGTGGACATTGACC
GCGGAGTACTGAAGGACTTCCTGGAGAAGACAGCTTCCTTGTCCCCGGAG
GAACGCGGACGGGCCCTCGAAAAAGACGAGAAGTTCACCGCCGATCATGA
GGCCTTGGCTCAAGAGGGCCAGACGAATGCCGCCAATCATGAGAAGGTGA
TCCACCACTTCATCGCACTGGTGAACAAGGAGGGTACTCTGTACGAGCTG
GATGGCCGCAAGTCCTTCCCGATCAAGCACGGACCGACTTCGGAGGAGAC
TTTTGTGAAGGATGCGGCCAAGGTCTGCAAGGAGTTCATGGCTCGCGATC
CCAACGAAGTGCGCTTCACCGTTTTGGCCTTGACCGCGGCACAACAAGCA
AGCTTTCTAGACCAT

BO05722.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-RB 684 CG4265-PB 1..681 17..697 3405 100 Plus
Uch-RA 684 CG4265-PA 1..681 17..697 3405 100 Plus
Uch-RC 675 CG4265-PC 1..672 17..697 3235 98.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-RB 1044 CG4265-RB 129..809 17..697 3405 100 Plus
Uch-RA 1196 CG4265-RA 281..961 17..697 3405 100 Plus
Uch-RC 1035 CG4265-RC 129..800 17..697 3235 98.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2212973..2213333 697..337 1805 100 Minus
2L 23513712 2L 2213415..2213557 336..194 715 100 Minus
2L 23513712 2L 2213616..2213758 193..51 715 100 Minus
2L 23513712 2L 2213894..2213931 54..17 190 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:38:18 has no hits.

BO05722.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:22:35 Download gff for BO05722.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 1..684 17..698 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:46:18 Download gff for BO05722.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 249..929 17..697 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:25 Download gff for BO05722.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 286..961 22..699 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:22:35 Download gff for BO05722.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 249..929 17..697 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:37 Download gff for BO05722.complete
Subject Subject Range Query Range Percent Splice Strand
Uch-RA 286..961 22..699 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:49:37 Download gff for BO05722.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2213896..2213926 22..52 100   Minus
2L 2213616..2213756 53..193 100 <- Minus
2L 2213415..2213557 194..336 100 <- Minus
2L 2212971..2213333 337..699 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:25 Download gff for BO05722.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2213896..2213926 22..52 100   Minus
arm_2L 2213616..2213756 53..193 100 <- Minus
arm_2L 2213415..2213557 194..336 100 <- Minus
arm_2L 2212971..2213333 337..699 99 <- Minus

BO05722.pep Sequence

Translation from 16 to 715

> BO05722.pep
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAF
ILLFPCSETYEKHRAEEHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIH
SVANNKEVDIDRGVLKDFLEKTASLSPEERGRALEKDEKFTADHEALAQE
GQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVKDA
AKVCKEFMARDPNEVRFTVLALTAAQQASFLDH

BO05722.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Uch-PB 227 CG4265-PB 1..227 1..227 1194 100 Plus
Uch-PA 227 CG4265-PA 1..227 1..227 1194 100 Plus
Uch-PC 224 CG4265-PC 1..224 1..227 1163 98.7 Plus
Uch-L5-PB 324 CG3431-PB 8..227 4..227 182 26.4 Plus
Uch-L5-PA 324 CG3431-PA 8..227 4..227 182 26.4 Plus