Clone BO05881 Report

Search the DGRC for BO05881

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:58
Well:81
Vector:pDNR-Dual
Associated Gene/Transcriptcbx-RB
Protein status:BO05881.pep: validated full length
Sequenced Size:766

Clone Sequence Records

BO05881.3prime Sequence

764 bp (763 high quality bases) assembled on 2005-12-02

> BO05881.3prime
ATGGTCTAGAAAGCTTGCCTCAATGCTAAGTGGCTTAAACTCGCCCTCCT
TAACCCATGACAGACCAGTTGCATGTCCACCATTTGCTTGTTGCGCTGAA
GGCTCCGTCAGCTTGCTTCTTCCGGCCTTGATGCGCTCCAGAACGGGCCC
GTGCACGTCCTGCTGGAACTTCTCGAATACTATGTAGTGCGGATCTTCGG
TGGGTGGGGTGTCAAATATATGCTCCTTGCTCTCCTTGATATTTTCCTGT
ACGCGAGCAACATACTCCTCCTTGTTATTCATCAGCAGCTCCGCAGCCTC
GCTGTTTTTGAGCTTATCTACCTCAATGCCCCGAATACTGTCCAAGGGAT
CGGAGAAAATGACTTGCAGGTACTTTAAAAGCTGCCAAAGGTGATCCTCT
CCACAGCGCCACTCCGGGAAGGCGTGGCTCACGTCCAAACTGTGGGTGTA
CGGGCACACATGGGGATGAATCACATCCTGCTGGAAAATTATGCTCGGAA
GACTTTTGTCGTCGGGAAAACGATCTGGGAGCAAAATTGTGAATCGAAAA
ACACTTTCCGCATACAAGCCCTGTCGGCCAAAGAAGACTCCAAACCACTG
CAAGGAGTTAGCATAGCTGGGTATCACATATATCCCACTCAACTTCTCCG
ACTCAATCATTTTGTATTCGGCCAGAATTTTATACTCCTGCTGTATGGTT
GTGATCAGCAACTTGTCATCTTTCTTATGCGCATCCAAATCGAGAGTCAT
GTCGACTGATAACT

BO05881.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10536-PB 735 cbx-RB 1..732 750..19 3660 100 Minus
CG10536-PA 645 cbx-RA 1..642 660..19 3210 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
cbx-RB 908 CG10536-RB 94..825 750..19 3660 100 Minus
cbx-RA 1036 CG10536-RA 253..953 719..19 3505 100 Minus
cbx-RC 766 CG10536-RC 72..456 723..321 1735 95.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9864593..9865070 19..496 2390 100 Plus
2R 25286936 2R 9865124..9865227 496..599 520 100 Plus
2R 25286936 2R 9865424..9865509 665..750 430 100 Plus
2R 25286936 2R 9865290..9865354 600..664 325 100 Plus
Blast to na_te.dros performed on 2015-02-13 00:42:21 has no hits.

BO05881.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:33:52 Download gff for BO05881.3prime
Subject Subject Range Query Range Percent Splice Strand
cbx-PB 1..735 15..750 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:00:19 Download gff for BO05881.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10536-PB 1..735 15..750 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:27:03 Download gff for BO05881.3prime
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 94..828 15..750 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:47:36 Download gff for BO05881.3prime
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 94..828 15..750 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:47:36 Download gff for BO05881.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 9865424..9865509 665..750 100   Plus
2R 9865290..9865354 600..664 100 <- Plus
2R 9865124..9865227 496..599 100 <- Plus
2R 9864589..9865069 15..495 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:27:03 Download gff for BO05881.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5752929..5753014 665..750 100   Plus
arm_2R 5752795..5752859 600..664 100 <- Plus
arm_2R 5752629..5752732 496..599 100 <- Plus
arm_2R 5752094..5752574 15..495 99 <- Plus

BO05881.5prime Sequence

727 bp (708 high quality bases) assembled on 2005-11-29

> BO05881.5prime
GAAGTTATCAGTCGACATGACTCTCGATTTGGATGCGCATAAGAAAGATG
ACAAGTTGCTGATCACAACCATACAGCAGGAGTATAAAATTCTGGCCGAA
TACAAAATGATTGAGTCGGAGAAGTTGAGTGGGATATATGTGATACCCAG
CTATGCTAACTCCTTGCAGTGGTTTGGAGTCTTCTTTGGCCGACAGGGCT
TGTATGCGGAAAGTGTTTTTCGATTCACAATTTTGCTCCCAGATCGTTTT
CCCGACGACAAAAGTCTTCCGAGCATAATTTTCCAGCAGGATGTGATTCA
TCCCCATGTGTGCCCGTACACCCACAGTTTGGACGTGAGCCACGCCTTCC
CGGAGTGGCGCTGTGGAGAGGATCACCTTTGGCAGCTTTTAAAGTACCTG
CAAGTCATTTTCTCCGATCCCTTGGACAGTATTCGGGGCATTGAGGTAGA
TAAGCTCAAAAACAGCGAGGCTGCGGAGCTGCTGATGAATAACAAGGAGG
AGTATGTTGCTCGCGTACAGGAAAATATCAAGGAGAGCAAGGAGCATATA
TTTGACACCCCACCCACCGAAGATCCGCACTACATAGTATTCGAGAAGTT
CCAGCAGGACGTGCACGGGCCCGTTCTGGAGCGCATCAAGGCCGGAAGAA
GCAAGCTGACGGAGCCTTCAGCGCAACAAGCAAATGGTGGACATGCAACT
GGTCTGTCATGGGTTAAGGAGGGCGAG

BO05881.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10536-PB 735 cbx-RB 1..711 17..727 3555 100 Plus
CG10536-PA 645 cbx-RA 1..621 107..727 3105 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
cbx-RB 908 CG10536-RB 94..804 17..727 3555 100 Plus
cbx-RA 1036 CG10536-RA 253..932 48..727 3400 100 Plus
cbx-RC 766 CG10536-RC 72..456 44..446 1735 95.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9864614..9865070 727..271 2285 100 Minus
2R 25286936 2R 9865124..9865227 271..168 520 100 Minus
2R 25286936 2R 9865424..9865509 102..17 430 100 Minus
2R 25286936 2R 9865290..9865354 167..103 325 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:25:20 has no hits.

BO05881.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:33:53 Download gff for BO05881.5prime
Subject Subject Range Query Range Percent Splice Strand
cbx-PB 1..711 17..727 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:00:20 Download gff for BO05881.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10536-PB 1..711 17..727 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:57:13 Download gff for BO05881.5prime
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 94..804 17..727 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:02:23 Download gff for BO05881.5prime
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 94..804 17..727 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:02:23 Download gff for BO05881.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 9865424..9865509 17..102 100   Minus
2R 9865290..9865354 103..167 100 <- Minus
2R 9865124..9865227 168..271 100 <- Minus
2R 9864614..9865069 272..727 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:57:13 Download gff for BO05881.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5752929..5753014 17..102 100   Minus
arm_2R 5752795..5752859 103..167 100 <- Minus
arm_2R 5752629..5752732 168..271 100 <- Minus
arm_2R 5752119..5752574 272..727 100 <- Minus

BO05881.complete Sequence

766 bp (766 high quality bases) assembled on 2005-10-19

GenBank Submission: FJ638631

> BO05881.complete
GAAGTTATCAGTCGACATGACTCTCGATTTGGATGCGCATAAGAAAGATG
ACAAGTTGCTGATCACAACCATACAGCAGGAGTATAAAATTCTGGCCGAA
TACAAAATGATTGAGTCGGAGAAGTTGAGTGGGATATATGTGATACCCAG
CTATGCTAACTCCTTGCAGTGGTTTGGAGTCTTCTTTGGCCGACAGGGCT
TGTATGCGGAAAGTGTTTTTCGATTCACAATTTTGCTCCCAGATCGTTTT
CCCGACGACAAAAGTCTTCCGAGCATAATTTTCCAGCAGGATGTGATTCA
TCCCCATGTGTGCCCGTACACCCACAGTTTGGACGTGAGCCACGCCTTCC
CGGAGTGGCGCTGTGGAGAGGATCACCTTTGGCAGCTTTTAAAGTACCTG
CAAGTCATTTTCTCCGATCCCTTGGACAGTATTCGGGGCATTGAGGTAGA
TAAGCTCAAAAACAGCGAGGCTGCGGAGCTGCTGATGAATAACAAGGAGG
AGTATGTTGCTCGCGTACAGGAAAATATCAAGGAGAGCAAGGAGCATATA
TTTGACACCCCACCCACCGAAGATCCGCACTACATAGTATTCGAGAAGTT
CCAGCAGGACGTGCACGGGCCCGTTCTGGAGCGCATCAAGGCCGGAAGAA
GCAAGCTGACGGAGCCTTCAGCGCAACAAGCAAATGGTGGACATGCAACT
GGTCTGTCATGGGTTAAGGAGGGCGAGTTTAAGCCACTTAGCATTGAGGC
AAGCTTTCTAGACCAT

BO05881.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
cbx-RB 735 CG10536-PB 1..732 17..748 3660 100 Plus
cbx-RA 645 CG10536-PA 1..642 107..748 3210 100 Plus
cbx-RC 552 CG10536-PC 1..322 107..446 1395 94.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
cbx-RB 908 CG10536-RB 94..825 17..748 3660 100 Plus
cbx-RA 1036 CG10536-RA 253..953 48..748 3505 100 Plus
cbx-RC 766 CG10536-RC 72..456 44..446 1710 95.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9864593..9865070 748..271 2390 100 Minus
2R 25286936 2R 9865124..9865227 271..168 520 100 Minus
2R 25286936 2R 9865424..9865509 102..17 430 100 Minus
2R 25286936 2R 9865290..9865354 167..103 325 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:06:26 has no hits.

BO05881.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:29:05 Download gff for BO05881.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 1..735 17..752 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:55:18 Download gff for BO05881.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 75..809 17..752 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:17:53 Download gff for BO05881.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 94..825 17..750 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:29:05 Download gff for BO05881.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 75..809 17..752 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:26:23 Download gff for BO05881.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 94..825 17..750 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:26:23 Download gff for BO05881.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9865424..9865509 17..102 100   Minus
2R 9865290..9865354 103..167 100 <- Minus
2R 9865124..9865227 168..271 100 <- Minus
2R 9864591..9865069 272..750 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:17:53 Download gff for BO05881.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5752929..5753014 17..102 100   Minus
arm_2R 5752795..5752859 103..167 100 <- Minus
arm_2R 5752629..5752732 168..271 100 <- Minus
arm_2R 5752096..5752574 272..750 99 <- Minus

BO05881.pep Sequence

Translation from 16 to 766

> BO05881.pep
MTLDLDAHKKDDKLLITTIQQEYKILAEYKMIESEKLSGIYVIPSYANSL
QWFGVFFGRQGLYAESVFRFTILLPDRFPDDKSLPSIIFQQDVIHPHVCP
YTHSLDVSHAFPEWRCGEDHLWQLLKYLQVIFSDPLDSIRGIEVDKLKNS
EAAELLMNNKEEYVARVQENIKESKEHIFDTPPTEDPHYIVFEKFQQDVH
GPVLERIKAGRSKLTEPSAQQANGGHATGLSWVKEGEFKPLSIEASFLDH

BO05881.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
cbx-PB 244 CG10536-PB 1..244 1..244 1290 100 Plus
cbx-PA 214 CG10536-PA 1..214 31..244 1139 100 Plus
cbx-PC 183 CG10536-PC 1..183 31..244 937 85.5 Plus
CG16894-PA 266 CG16894-PA 11..211 16..209 492 45.5 Plus