Clone BO05967 Report

Search the DGRC for BO05967

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:59
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptPros25-RA
Protein status:BO05967.pep: validated full length
Sequenced Size:736

Clone Sequence Records

BO05967.3prime Sequence

734 bp (733 high quality bases) assembled on 2005-12-02

> BO05967.3prime
ATGGTCTAGAAAGCTTGCGGGGATGCTGGCCAAGTAGTCCTTGATTGAGG
CGGGGTCCAGACGCTGGAATCCGTTCTGATCGCAGATTCCGATCTCAATG
TTGTCGGCAGTCATTTTTCCCTCAAAACCTTCTTTCAGCGTAAGGATGGC
GGTGTGAACAGCGTCGTCCAGCTCCAGATCTTCGCTGTAGCGCTTCTCCA
GGAAAGTTTTGCCGTTCACTGCGTTCTTGCCCATGGCAGTGGCCTTCCAG
GCGAAGTAGGCGCCCGAAGGATCGGATTGGTAGAGATACGGACGATCATT
GTCCCAGCCGCAGATCAGTAGGGAAACGCCAAAGGGACGAACGCCACCGG
ACTGAGTGTACTCCTGCATGAGCGTGGCCACGCGCTGCACCAGCTGTGAC
ACTGGAATCGGCTCCTTGTAGGTCAGGTAGTACGTCTGGGCGATCTTGCG
GGCCTGCTTGACCAGCAGGCGGTAGTCCGGACCCATTCCCGAGTACACCA
TGCCGATGTGGTTGTAGATCATCTCCACGCGATGTACACTGTGCTGCTCA
TACAGCGGTGACTTGTGTTTGTTCTCTGTGGCAATGACGACGCCGTTGGA
AGCTATAATGCCCACGGAGGGAGCTCCGCCAGATACGGCCGCCAATGCAT
ACTCCAGTTGGACGAGTTTTCCGGAAGGACTGAACGTGGTCAACGAAAAG
CTGTATCGTTCGGTAGCCATGTCGACTGATAACT

BO05967.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5266-PA 705 Pros25-RA 1..702 720..19 3510 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha2-RA 920 CG5266-RA 121..822 720..19 3510 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12431743..12432001 605..347 1295 100 Minus
3R 32079331 3R 12432286..12432458 191..19 865 100 Minus
3R 32079331 3R 12432066..12432222 347..191 785 100 Minus
3R 32079331 3R 12431581..12431660 682..603 400 100 Minus
3R 32079331 3R 12431441..12431481 720..680 205 100 Minus
Blast to na_te.dros performed on 2015-02-13 00:33:50 has no hits.

BO05967.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:36:01 Download gff for BO05967.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5266-PA 1..705 15..720 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:03:22 Download gff for BO05967.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5266-PA 1..705 15..720 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:13:23 Download gff for BO05967.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 113..829 11..728 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:46:32 Download gff for BO05967.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 113..829 11..728 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:46:32 Download gff for BO05967.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 12432287..12432465 11..190 98   Minus
3R 12432067..12432222 191..346 100 -> Minus
3R 12431746..12432001 347..602 100 -> Minus
3R 12431584..12431660 603..679 100 -> Minus
3R 12431433..12431481 680..728 91 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:13:23 Download gff for BO05967.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8258009..8258187 11..190 98   Minus
arm_3R 8257789..8257944 191..346 100 -> Minus
arm_3R 8257468..8257723 347..602 100 -> Minus
arm_3R 8257306..8257382 603..679 100 -> Minus
arm_3R 8257155..8257203 680..728 91 -> Minus

BO05967.5prime Sequence

734 bp (733 high quality bases) assembled on 2005-12-02

> BO05967.5prime
GAAGTTATCAGTCGACATGGCTACCGAACGATACAGCTTTTCGTTGACCA
CGTTCAGTCCTTCCGGAAAACTCGTCCAACTGGAGTATGCATTGGCGGCC
GTATCTGGCGGAGCTCCCTCCGTGGGCATTATAGCTTCCAACGGCGTCGT
CATTGCCACAGAGAACAAACACAAGTCACCGCTGTATGAGCAGCACAGTG
TACATCGCGTGGAGATGATCTACAACCACATCGGCATGGTGTACTCGGGA
ATGGGTCCGGACTACCGCCTGCTGGTCAAGCAGGCCCGCAAGATCGCCCA
GACGTACTACCTGACCTACAAGGAGCCGATTCCAGTGTCACAGCTGGTGC
AGCGCGTGGCCACGCTCATGCAGGAGTACACTCAGTCCGGTGGCGTTCGT
CCCTTTGGCGTTTCCCTACTGATCTGCGGCTGGGACAATGATCGTCCGTA
TCTCTACCAATCCGATCCTTCGGGCGCCTACTTCGCCTGGAAGGCCACTG
CCATGGGCAAGAACGCAGTGAACGGCAAAACTTTCCTGGAGAAGCGCTAC
AGCGAAGATCTGGAGCTGGACGACGCTGTTCACACCGCCATCCTTACGCT
GAAAGAAGGTTTTGAGGGAAAAATGACTGCCGACAACATTGAGATCGGAA
TCTGCGATCAGAACGGATTCCAGCGTCTGGACCCCGCCTCAATCAAGGAC
TACTTGGCCAGCATCCCCGCAAGCTTTCTAGACC

BO05967.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5266-PA 705 Pros25-RA 1..702 17..718 3510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 11:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha2-RA 920 CG5266-RA 121..822 17..718 3510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 11:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12431743..12432001 132..390 1295 100 Plus
3R 32079331 3R 12432286..12432458 546..718 865 100 Plus
3R 32079331 3R 12432066..12432222 390..546 785 100 Plus
3R 32079331 3R 12431581..12431660 55..134 400 100 Plus
3R 32079331 3R 12431441..12431481 17..57 205 100 Plus
Blast to na_te.dros performed on 2015-02-13 11:59:17 has no hits.

BO05967.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:36:02 Download gff for BO05967.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5266-PA 1..705 17..722 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:03:24 Download gff for BO05967.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5266-PA 1..705 17..722 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:55:39 Download gff for BO05967.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 113..829 9..726 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:20:32 Download gff for BO05967.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 113..829 9..726 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:20:32 Download gff for BO05967.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 12432287..12432465 547..726 98   Plus
3R 12432067..12432222 391..546 100 -> Plus
3R 12431746..12432001 135..390 100 -> Plus
3R 12431584..12431660 58..134 100 -> Plus
3R 12431433..12431481 9..57 91 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:55:39 Download gff for BO05967.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8258009..8258187 547..726 98   Plus
arm_3R 8257789..8257944 391..546 100 -> Plus
arm_3R 8257468..8257723 135..390 100 -> Plus
arm_3R 8257306..8257382 58..134 100 -> Plus
arm_3R 8257155..8257203 9..57 91 -> Plus

BO05967.complete Sequence

736 bp (736 high quality bases) assembled on 2005-10-19

GenBank Submission: FJ630209

> BO05967.complete
GAAGTTATCAGTCGACATGGCTACCGAACGATACAGCTTTTCGTTGACCA
CGTTCAGTCCTTCCGGAAAACTCGTCCAACTGGAGTATGCATTGGCGGCC
GTATCTGGCGGAGCTCCCTCCGTGGGCATTATAGCTTCCAACGGCGTCGT
CATTGCCACAGAGAACAAACACAAGTCACCGCTGTATGAGCAGCACAGTG
TACATCGCGTGGAGATGATCTACAACCACATCGGCATGGTGTACTCGGGA
ATGGGTCCGGACTACCGCCTGCTGGTCAAGCAGGCCCGCAAGATCGCCCA
GACGTACTACCTGACCTACAAGGAGCCGATTCCAGTGTCACAGCTGGTGC
AGCGCGTGGCCACGCTCATGCAGGAGTACACTCAGTCCGGTGGCGTTCGT
CCCTTTGGCGTTTCCCTACTGATCTGCGGCTGGGACAATGATCGTCCGTA
TCTCTACCAATCCGATCCTTCGGGCGCCTACTTCGCCTGGAAGGCCACTG
CCATGGGCAAGAACGCAGTGAACGGCAAAACTTTCCTGGAGAAGCGCTAC
AGCGAAGATCTGGAGCTGGACGACGCTGTTCACACCGCCATCCTTACGCT
GAAAGAAGGTTTTGAGGGAAAAATGACTGCCGACAACATTGAGATCGGAA
TCTGCGATCAGAACGGATTCCAGCGTCTGGACCCCGCCTCAATCAAGGAC
TACTTGGCCAGCATCCCCGCAAGCTTTCTAGACCAT

BO05967.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha2-RA 705 CG5266-PA 1..702 17..718 3510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha2-RA 920 CG5266-RA 121..822 17..718 3510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12431743..12432001 132..390 1295 100 Plus
3R 32079331 3R 12432286..12432458 546..718 865 100 Plus
3R 32079331 3R 12432066..12432222 390..546 785 100 Plus
3R 32079331 3R 12431581..12431660 55..134 400 100 Plus
3R 32079331 3R 12431441..12431481 17..57 205 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:28:12 has no hits.

BO05967.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:28:38 Download gff for BO05967.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 1..705 17..722 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:54:35 Download gff for BO05967.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 109..825 9..726 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:47:03 Download gff for BO05967.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 121..822 17..720 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:28:39 Download gff for BO05967.complete
Subject Subject Range Query Range Percent Splice Strand
Pros25-RA 109..825 9..726 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:29 Download gff for BO05967.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha2-RA 121..822 17..720 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:08:29 Download gff for BO05967.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12432287..12432458 547..720 98   Plus
3R 12432067..12432222 391..546 100 -> Plus
3R 12431746..12432001 135..390 100 -> Plus
3R 12431584..12431660 58..134 100 -> Plus
3R 12431441..12431481 17..57 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:47:03 Download gff for BO05967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8258009..8258180 547..720 98   Plus
arm_3R 8257789..8257944 391..546 100 -> Plus
arm_3R 8257468..8257723 135..390 100 -> Plus
arm_3R 8257306..8257382 58..134 100 -> Plus
arm_3R 8257163..8257203 17..57 100 -> Plus

BO05967.pep Sequence

Translation from 16 to 736

> BO05967.pep
MATERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATEN
KHKSPLYEQHSVHRVEMIYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLT
YKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDNDRPYLYQSD
PSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGFE
GKMTADNIEIGICDQNGFQRLDPASIKDYLASIPASFLDH

BO05967.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha2-PA 234 CG5266-PA 1..234 1..234 1214 100 Plus
Prosalpha4-PA 249 CG3422-PA 2..234 3..233 368 36.4 Plus
Prosalpha4T2-PB 252 CG4569-PB 3..186 4..186 358 37.5 Plus
Prosalpha4T2-PA 252 CG4569-PA 3..186 4..186 358 37.5 Plus
Prosalpha5-PB 244 CG10938-PB 3..219 1..210 342 33.2 Plus