Clone BO06077 Report

Search the DGRC for BO06077

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:60
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCHOp24-RA
Protein status:BO06077.pep: validated full length
Sequenced Size:658

Clone Sequence Records

BO06077.3prime Sequence

656 bp (655 high quality bases) assembled on 2005-12-02

> BO06077.3prime
ATGGTCTAGAAAGCTTGCCACGACGCGCTTGACCTCGAAGAAGCGTTTCA
GGTAGTACACCTGGCCCACTGTCATCAGGACCAGGACGAGGGCTTCGAAG
GTGGACCACAGCACCACTCGCGAGTTGGTGTTCTCGTTCACCGAACGATG
GATCTTGTCGCGCACATGCATGTACTCCTGTTCGTGCTTGACACTGGTCA
GCGTGCCGGAGAGCTCCCGAATCATGTCCTCCAGCTTGGTGTGGCCCACC
TCCTCCTCGCCGGGTGCTCCGGGCGCACGTTGCGGTGCGTCACCCACGTC
GATGGAGAACATGACCAGCTTGGGGGTCATGCTGCTGCGTTCGTTGTTGA
AGCACACGGTGTAGGTTCCCTTGGCGGGGGCCACAAAGGTGTACTTGCCG
GACGACTCCTTTTCGCTCTCGTGCATCACATGGTTATCCGGGCCGCTGAT
CTTGATGTCCACGTCTAGGAAGCCACCGTCGATCACCTCGAAGGTGACGC
CAAACTTGGTGCCGCCTTCGACGTTCTCGAAGAAGCACTCCTCATTGTGG
GCGTCCACGCTGACGATGAAGGCGTGGCTGGTGCGGCACAGGATCAGCAG
GCTGCCCACAAGGAGCAGCACCTTGGCGAGTGTCGATTCCATGTCGACTG
ATAACT

BO06077.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG3564-PA 627 CG3564-RA 1..624 642..19 3120 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-RB 1172 CG3564-RB 96..719 642..19 3120 100 Minus
CHOp24-RA 1104 CG3564-RA 96..719 642..19 3120 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4541216..4541554 501..163 1695 100 Minus
X 23542271 X 4541907..4542053 165..19 735 100 Minus
X 23542271 X 4541003..4541145 642..500 715 100 Minus
Blast to na_te.dros performed 2015-02-12 06:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 3518..3551 59..26 107 79.4 Minus

BO06077.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:39:20 Download gff for BO06077.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3564-PA 1..627 15..642 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:08:04 Download gff for BO06077.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3564-PA 1..627 15..642 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:31:09 Download gff for BO06077.3prime
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 90..722 15..650 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:29:03 Download gff for BO06077.3prime
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 90..722 15..650 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:29:03 Download gff for BO06077.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4541907..4542056 15..165 98   Minus
X 4541217..4541551 166..500 100 -> Minus
X 4540997..4541144 501..650 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:31:09 Download gff for BO06077.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4435940..4436089 15..165 98   Minus
arm_X 4435250..4435584 166..500 100 -> Minus
arm_X 4435030..4435177 501..650 97 -> Minus

BO06077.5prime Sequence

656 bp (655 high quality bases) assembled on 2005-12-02

> BO06077.5prime
GAAGTTATCAGTCGACATGGAATCGACACTCGCCAAGGTGCTGCTCCTTG
TGGGCAGCCTGCTGATCCTGTGCCGCACCAGCCACGCCTTCATCGTCAGC
GTGGACGCCCACAATGAGGAGTGCTTCTTCGAGAACGTCGAAGGCGGCAC
CAAGTTTGGCGTCACCTTCGAGGTGATCGACGGTGGCTTCCTAGACGTGG
ACATCAAGATCAGCGGCCCGGATAACCATGTGATGCACGAGAGCGAAAAG
GAGTCGTCCGGCAAGTACACCTTTGTGGCCCCCGCCAAGGGAACCTACAC
CGTGTGCTTCAACAACGAACGCAGCAGCATGACCCCCAAGCTGGTCATGT
TCTCCATCGACGTGGGTGACGCACCGCAACGTGCGCCCGGAGCACCCGGC
GAGGAGGAGGTGGGCCACACCAAGCTGGAGGACATGATTCGGGAGCTCTC
CGGCACGCTGACCAGTGTCAAGCACGAACAGGAGTACATGCATGTGCGCG
ACAAGATCCATCGTTCGGTGAACGAGAACACCAACTCGCGAGTGGTGCTG
TGGTCCACCTTCGAAGCCCTCGTCCTGGTCCTGATGACAGTGGGCCAGGT
GTACTACCTGAAACGCTTCTTCGAGGTCAAGCGCGTCGTGGCAAGCTTTC
TAGACC

BO06077.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG3564-PA 627 CG3564-RA 1..624 17..640 3120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 19:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-RB 1172 CG3564-RB 96..719 17..640 3120 100 Plus
CHOp24-RA 1104 CG3564-RA 96..719 17..640 3120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 19:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4541216..4541554 158..496 1695 100 Plus
X 23542271 X 4541907..4542053 494..640 735 100 Plus
X 23542271 X 4541003..4541145 17..159 715 100 Plus
Blast to na_te.dros performed 2015-02-04 19:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 3518..3551 600..633 107 79.4 Plus

BO06077.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:39:21 Download gff for BO06077.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3564-PA 1..627 17..644 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:08:05 Download gff for BO06077.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3564-PA 1..627 17..644 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:21:03 Download gff for BO06077.5prime
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 90..722 9..644 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:43:41 Download gff for BO06077.5prime
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 90..722 9..644 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:43:41 Download gff for BO06077.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4541907..4542056 494..644 98   Plus
X 4541217..4541551 159..493 100 -> Plus
X 4540997..4541144 9..158 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:21:03 Download gff for BO06077.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4435940..4436089 494..644 98   Plus
arm_X 4435250..4435584 159..493 100 -> Plus
arm_X 4435030..4435177 9..158 97 -> Plus

BO06077.complete Sequence

658 bp (658 high quality bases) assembled on 2005-10-20

GenBank Submission: FJ630276

> BO06077.complete
GAAGTTATCAGTCGACATGGAATCGACACTCGCCAAGGTGCTGCTCCTTG
TGGGCAGCCTGCTGATCCTGTGCCGCACCAGCCACGCCTTCATCGTCAGC
GTGGACGCCCACAATGAGGAGTGCTTCTTCGAGAACGTCGAAGGCGGCAC
CAAGTTTGGCGTCACCTTCGAGGTGATCGACGGTGGCTTCCTAGACGTGG
ACATCAAGATCAGCGGCCCGGATAACCATGTGATGCACGAGAGCGAAAAG
GAGTCGTCCGGCAAGTACACCTTTGTGGCCCCCGCCAAGGGAACCTACAC
CGTGTGCTTCAACAACGAACGCAGCAGCATGACCCCCAAGCTGGTCATGT
TCTCCATCGACGTGGGTGACGCACCGCAACGTGCGCCCGGAGCACCCGGC
GAGGAGGAGGTGGGCCACACCAAGCTGGAGGACATGATTCGGGAGCTCTC
CGGCACGCTGACCAGTGTCAAGCACGAACAGGAGTACATGCATGTGCGCG
ACAAGATCCATCGTTCGGTGAACGAGAACACCAACTCGCGAGTGGTGCTG
TGGTCCACCTTCGAAGCCCTCGTCCTGGTCCTGATGACAGTGGGCCAGGT
GTACTACCTGAAACGCTTCTTCGAGGTCAAGCGCGTCGTGGCAAGCTTTC
TAGACCAT

BO06077.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-RB 627 CG3564-PB 1..624 17..640 3120 100 Plus
CHOp24-RA 627 CG3564-PA 1..624 17..640 3120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-RB 1172 CG3564-RB 96..719 17..640 3120 100 Plus
CHOp24-RA 1104 CG3564-RA 96..719 17..640 3120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4541216..4541554 158..496 1695 100 Plus
X 23542271 X 4541907..4542053 494..640 735 100 Plus
X 23542271 X 4541003..4541145 17..159 715 100 Plus
Blast to na_te.dros performed 2014-11-27 01:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 3518..3551 600..633 107 79.4 Plus

BO06077.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:53:35 Download gff for BO06077.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 1..627 17..644 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:25:45 Download gff for BO06077.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 88..720 9..644 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:11 Download gff for BO06077.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 96..719 17..642 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:53:35 Download gff for BO06077.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 88..720 9..644 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:27:19 Download gff for BO06077.complete
Subject Subject Range Query Range Percent Splice Strand
CHOp24-RA 96..719 17..642 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:27:19 Download gff for BO06077.complete
Subject Subject Range Query Range Percent Splice Strand
X 4541907..4542053 494..642 98   Plus
X 4541217..4541551 159..493 100 -> Plus
X 4541003..4541144 17..158 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:11 Download gff for BO06077.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4435940..4436086 494..642 98   Plus
arm_X 4435250..4435584 159..493 100 -> Plus
arm_X 4435036..4435177 17..158 100 -> Plus

BO06077.pep Sequence

Translation from 16 to 658

> BO06077.pep
MESTLAKVLLLVGSLLILCRTSHAFIVSVDAHNEECFFENVEGGTKFGVT
FEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNN
ERSSMTPKLVMFSIDVGDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTS
VKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKR
FFEVKRVVASFLDH

BO06077.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
CHOp24-PB 208 CG3564-PB 1..208 1..208 1072 100 Plus
CHOp24-PA 208 CG3564-PA 1..208 1..208 1072 100 Plus
CG9308-PA 203 CG9308-PA 8..203 15..208 409 40.8 Plus
p24-1-PB 210 CG1967-PB 4..197 7..202 238 27 Plus
p24-1-PA 210 CG1967-PA 4..197 7..202 238 27 Plus