Clone BO06220 Report

Search the DGRC for BO06220

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:62
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptRab-RP4-RA
Protein status:BO06220.pep: validated full length
Sequenced Size:625

Clone Sequence Records

BO06220.3prime Sequence

623 bp (622 high quality bases) assembled on 2005-12-03

> BO06220.3prime
ATGGTCTAGAAAGCTTGCACAGTAACACGTAGACGCGCTTGCCTCCAGAT
CCCGATCGCTGGCGATGTCCAGACCGGCGGAGGCATTGCCATTGTTGAAG
TATTCGGAGGAGACGATCTTCTCCACCACATCTTTGAACACATCGCTGAC
GAACTGATCGCATTTGGCTGAGGTCTCGATGAAGAGCGCCCTGTGCTTCC
TGGCAAACTTTCGACCCTCCTCGCGATCCACAACTCGCTCCTCGTCGATC
TTGTTGCCTACCACAATGATGGCAATGTTGGGATTGTCGCTGTAGCTATC
CAGTTCAGCCAGCCAGGTTTCCAGCTTGACCAGGCTGTCCCTGCTGGTGA
TGTCGTACACTAGAATGGCGCCCAGAGCCTTCCGATAGAAACTGGGCGTC
AGGCTGCGGAATCTCTCGGCGCCCGCCGTATCCCACAGGGCCACCTTGTA
GTCTATGCCGTCCACCTGCATCACTTTGCTCTTGAAGTCCATGCCAATCG
TGACGTCATGGTTCTGGTCGAACTTGTTCTCCACGAAGCGACGTATCAAA
CTGGACTTGCCCACGCCGCTTTCCCCGATCACCAGCAGCTTGATAGCCCG
ATCAGCCATGTCGACTGATAACT

BO06220.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3129-PA 594 Rab-RP4-RA 1..591 609..19 2955 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rab18-RA 833 CG3129-RA 152..742 609..19 2955 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5671081..5671515 118..552 2175 100 Plus
X 23542271 X 5670918..5671018 19..119 505 100 Plus
X 23542271 X 5671603..5671661 551..609 295 100 Plus
Blast to na_te.dros performed on 2015-02-13 12:05:49 has no hits.

BO06220.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:43:28 Download gff for BO06220.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3129-PA 1..594 16..609 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:13:56 Download gff for BO06220.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3129-PA 1..594 16..609 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:57:38 Download gff for BO06220.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 146..742 19..617 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:25:13 Download gff for BO06220.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 146..742 19..617 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:25:13 Download gff for BO06220.3prime
Subject Subject Range Query Range Percent Splice Strand
X 5671603..5671665 551..617 94   Plus
X 5671081..5671513 118..550 100 <- Plus
X 5670918..5671016 19..117 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:57:38 Download gff for BO06220.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 5565636..5565698 551..617 94   Plus
arm_X 5565114..5565546 118..550 100 <- Plus
arm_X 5564951..5565049 19..117 100 <- Plus

BO06220.5prime Sequence

623 bp (622 high quality bases) assembled on 2005-12-03

> BO06220.5prime
GAAGTTATCAGTCGACATGGCTGATCGGGCTATCAAGCTGCTGGTGATCG
GGGAAAGCGGCGTGGGCAAGTCCAGTTTGATACGTCGCTTCGTGGAGAAC
AAGTTCGACCAGAACCATGACGTCACGATTGGCATGGACTTCAAGAGCAA
AGTGATGCAGGTGGACGGCATAGACTACAAGGTGGCCCTGTGGGATACGG
CGGGCGCCGAGAGATTCCGCAGCCTGACGCCCAGTTTCTATCGGAAGGCT
CTGGGCGCCATTCTAGTGTACGACATCACCAGCAGGGACAGCCTGGTCAA
GCTGGAAACCTGGCTGGCTGAACTGGATAGCTACAGCGACAATCCCAACA
TTGCCATCATTGTGGTAGGCAACAAGATCGACGAGGAGCGAGTTGTGGAT
CGCGAGGAGGGTCGAAAGTTTGCCAGGAAGCACAGGGCGCTCTTCATCGA
GACCTCAGCCAAATGCGATCAGTTCGTCAGCGATGTGTTCAAAGATGTGG
TGGAGAAGATCGTCTCCTCCGAATACTTCAACAATGGCAATGCCTCCGCC
GGTCTGGACATCGCCAGCGATCGGGATCTGGAGGCAAGCGCGTCTACGTG
TTACTGTGCAAGCTTTCTAGACC

BO06220.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3129-PA 594 Rab-RP4-RA 1..591 17..607 2955 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Rab18-RA 833 CG3129-RA 152..742 17..607 2955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5671081..5671515 508..74 2175 100 Minus
X 23542271 X 5670918..5671018 607..507 505 100 Minus
X 23542271 X 5671603..5671661 75..17 295 100 Minus
Blast to na_te.dros performed on 2015-02-11 22:35:14 has no hits.

BO06220.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:43:29 Download gff for BO06220.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3129-PA 1..594 17..610 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:13:58 Download gff for BO06220.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3129-PA 1..594 17..610 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:41:16 Download gff for BO06220.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 146..742 9..607 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:09:15 Download gff for BO06220.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 146..742 9..607 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:09:15 Download gff for BO06220.5prime
Subject Subject Range Query Range Percent Splice Strand
X 5671603..5671665 9..75 94   Minus
X 5671081..5671513 76..508 100 <- Minus
X 5670918..5671016 509..607 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:41:16 Download gff for BO06220.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 5565636..5565698 9..75 94   Minus
arm_X 5565114..5565546 76..508 100 <- Minus
arm_X 5564951..5565049 509..607 100 <- Minus

BO06220.complete Sequence

625 bp (625 high quality bases) assembled on 2005-10-27

GenBank Submission: FJ630306

> BO06220.complete
GAAGTTATCAGTCGACATGGCTGATCGGGCTATCAAGCTGCTGGTGATCG
GGGAAAGCGGCGTGGGCAAGTCCAGTTTGATACGTCGCTTCGTGGAGAAC
AAGTTCGACCAGAACCATGACGTCACGATTGGCATGGACTTCAAGAGCAA
AGTGATGCAGGTGGACGGCATAGACTACAAGGTGGCCCTGTGGGATACGG
CGGGCGCCGAGAGATTCCGCAGCCTGACGCCCAGTTTCTATCGGAAGGCT
CTGGGCGCCATTCTAGTGTACGACATCACCAGCAGGGACAGCCTGGTCAA
GCTGGAAACCTGGCTGGCTGAACTGGATAGCTACAGCGACAATCCCAACA
TTGCCATCATTGTGGTAGGCAACAAGATCGACGAGGAGCGAGTTGTGGAT
CGCGAGGAGGGTCGAAAGTTTGCCAGGAAGCACAGGGCGCTCTTCATCGA
GACCTCAGCCAAATGCGATCAGTTCGTCAGCGATGTGTTCAAAGATGTGG
TGGAGAAGATCGTCTCCTCCGAATACTTCAACAATGGCAATGCCTCCGCC
GGTCTGGACATCGCCAGCGATCGGGATCTGGAGGCAAGCGCGTCTACGTG
TTACTGTGCAAGCTTTCTAGACCAT

BO06220.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Rab18-RA 594 CG3129-PA 1..591 17..607 2955 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Rab18-RA 833 CG3129-RA 152..742 17..607 2955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5671081..5671515 508..74 2175 100 Minus
X 23542271 X 5670918..5671018 607..507 505 100 Minus
X 23542271 X 5671603..5671661 75..17 295 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:08:21 has no hits.

BO06220.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:08:33 Download gff for BO06220.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 1..594 17..610 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:28:23 Download gff for BO06220.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 143..739 9..607 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:39 Download gff for BO06220.complete
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 152..742 17..609 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:08:33 Download gff for BO06220.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 143..739 9..607 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:04:15 Download gff for BO06220.complete
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 152..742 17..609 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:04:15 Download gff for BO06220.complete
Subject Subject Range Query Range Percent Splice Strand
X 5671603..5671661 17..75 100   Minus
X 5671081..5671513 76..508 100 <- Minus
X 5670915..5671016 509..609 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:39 Download gff for BO06220.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5565636..5565694 17..75 100   Minus
arm_X 5565114..5565546 76..508 100 <- Minus
arm_X 5564948..5565049 509..609 98 <- Minus

BO06220.pep Sequence

Translation from 16 to 625

> BO06220.pep
MADRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVD
GIDYKVALWDTAGAERFRSLTPSFYRKALGAILVYDITSRDSLVKLETWL
AELDSYSDNPNIAIIVVGNKIDEERVVDREEGRKFARKHRALFIETSAKC
DQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIASDRDLEASASTCYCASF
LDH

BO06220.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Rab18-PA 197 CG3129-PA 1..197 1..197 998 100 Plus
Rab2-PB 213 CG3269-PB 8..183 7..177 379 43.5 Plus
Rab2-PA 213 CG3269-PA 8..183 7..177 379 43.5 Plus
Rab4-PA 213 CG4921-PA 6..177 3..169 354 44.5 Plus
Rab4-PB 213 CG4921-PB 6..177 3..169 354 44.5 Plus