Clone BO06273 Report

Search the DGRC for BO06273

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:62
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptgammaSnap-RA
Protein status:BO06273.pep: validated full length
Sequenced Size:940

Clone Sequence Records

BO06273.3prime Sequence

931 bp (828 high quality bases) assembled on 2005-12-03

> BO06273.3prime
ATGGTCTAGAAAGCTTGCGCACAAGCCACCTTCGTCCTCGGCGTCGTTGG
TTTCAGCAGCAGTGTCGCCAGCCTTCTTCTCCATCTGTATACCCTGAGGT
AGTGGAATGTTTTTAGATAGAATAGCGTACTCAACATCCATATGTCGTAT
GAATGGGGATGCCAGCATCCTAGCAGCTAACTCGGGATCCTCGTCATCGA
AGGCTTGCAGAAGGGTCTGCAGTGTGGACACTTCCTCTGGCTCGCAGCAG
TTTCCCCACTCCCTGAAGGTCTTTTCGGCTTCCACGGAATCCCCGCGAGC
CAGTTGGACCATCACCAAGGCCACAACTAGGCGTCCAATTTGTCCGTAAG
ATTCCGTTTGCTGATTCAAGCTGATCTCCTTTTTGAGCGCATTCGTGGCT
TCGTCGTACCTCCTTAGTTTGACCAGTATCCTGGAAACTTTTGATGCATA
CTCGGCTGCTTGACGGACGGAATCCTCGATCATTATGACTTCTAGAGCAT
GCTGATAGAAGCGCAAAGCCATGTCAGGATGCTTGGATTCAGTTAACTTG
GCGGCTTTATCCAAGGCGGATGCGGCTGCCTCTGGGGAACCGTGCTGTTG
ATACAAACTCGCCGATTTGTTGGCGTATTCCTCAACTTCGTGTAGCTTAT
CGGCATCCTTTGACAGCAAAATGATCTGTTCGTATGCCTTTGCAGCATGG
AACCAAGACTTGTTGTTTTTATAGGCGTCGATTGCCTTCAGAAAACACTC
CTTGCTCTTATCATAACTTTTAGCTATTCGATATGCAGTGGCAGCTTTGG
AATACTCATCCGCAGCACTATCGTAATCAGGAACCCATTTCAGCATGGAC
AACTTCAAGCTCTTCTCGGGCTGCTTCACCAGGTCCTCCGCTTCGGCAAT
CTTTTGGCAGCGATTCCCGACATGTCGACTG

BO06273.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3988-PA 909 gammaSnap-RA 20..906 905..19 4410 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-RA 1117 CG3988-RA 71..976 923..19 4490 99.8 Minus
sei-RC 3197 CG3182-RC 137..384 164..411 1240 100 Plus
gammaSnap2-RA 1002 CG6208-RA 119..812 805..112 725 74 Minus
sei-RC 3197 CG3182-RC 446..520 407..481 375 100 Plus
sei-RC 3197 CG3182-RC 94..138 54..98 225 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24047504..24047861 54..411 1790 100 Plus
2R 25286936 2R 24048066..24048262 481..677 985 100 Plus
3R 32079331 3R 10120589..10121282 112..805 725 73.6 Plus
2R 25286936 2R 24048335..24048451 676..792 585 100 Plus
2R 25286936 2R 24047923..24047997 407..481 375 100 Plus
2R 25286936 2R 24048639..24048708 792..861 350 100 Plus
2R 25286936 2R 24048769..24048833 860..923 260 96.9 Plus
Blast to na_te.dros performed on 2015-02-13 15:56:21 has no hits.

BO06273.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:44:52 Download gff for BO06273.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3988-PA 1..909 15..923 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:15:52 Download gff for BO06273.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3988-PA 1..909 15..923 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:07:11 Download gff for BO06273.3prime
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 64..985 8..929 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:20:11 Download gff for BO06273.3prime
Subject Subject Range Query Range Percent Splice Strand
gammaSnap1-RA 64..985 8..929 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:20:11 Download gff for BO06273.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 24048769..24048840 860..929 93   Plus
2R 24048639..24048706 792..859 100 <- Plus
2R 24048335..24048450 676..791 100 <- Plus
2R 24048066..24048260 481..675 100 <- Plus
2R 24047926..24047996 410..480 100 <- Plus
2R 24047505..24047859 55..409 100 <- Plus
2R 24047277..24047321 8..54 91 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:07:11 Download gff for BO06273.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19936292..19936363 860..929 93   Plus
arm_2R 19936162..19936229 792..859 100 <- Plus
arm_2R 19935858..19935973 676..791 100 <- Plus
arm_2R 19935589..19935783 481..675 100 <- Plus
arm_2R 19935449..19935519 410..480 100 <- Plus
arm_2R 19935028..19935382 55..409 100 <- Plus
arm_2R 19934800..19934844 8..54 91 <- Plus

BO06273.5prime Sequence

887 bp (730 high quality bases) assembled on 2005-12-03

> BO06273.5prime
GAAGTTATCAGTCGACATGTCGGGAATCGCTGCCAAAAAGATTGCCGAAG
CGGAGGACCTGGTGAAGCAGGCCGAGAAGAGCTTGAAGTTGTCCATGCTG
AAATGGGTTCCTGATTACGATAGTGCTGCGGATGAGTATTCCAAAGCTGC
CACTGCATATCGAATAGCTAAAAGTTATGATAAGAGCAAGGAGTGTTTTC
TGAAGGCAATCGACGCCTATAAAAACAACAAGTCTTGGTTCCATGCTGCA
AAGGCATACGAACAGATCATTTTGCTGTCAAAGGATGCCGATAAGCTACA
CGAAGTTGAGGAATACGCCAACAAATCGGCGAGTTTGTATCAACAGCACG
GTTCCCCAGAGGCAGCCGCATCCGCCTTGGATAAAGCCGCCAAGTTAACT
GAATCCAAGCATCCTGACATGGCTTTGCGCTTCTATCAGCATGCTCTAGA
AGTCATAATGATCGAGGATTCCGTCCGTCAAGCAGCCGAGTATGCATCAA
AAGTTTCCAGGATACTGGTCAAACTAAGGAGGTACGACGAAGCCACGAAT
GCGCTCAAAAAGGAGATCAGCTTGAATCAGCAAACGGAATCTTACGGACA
AATTGGACGCCTAGTTGTGGCCTTGGTGATGGTCCAACTGGCTCGCGGGG
ATTCCGTGGAAGCCGAAAAGACCTTCAGGGAGTGGGGAAACTGCTGCGAG
CCAGAGGAAGTGTCCACACTGCAGACCCTTCTGTCAGCCTTCGATGACGA
GGATCCCGAGTTAGCTGCTAGGATGCTGGCATCCCCATTCATACGACATA
TGGATGTTGAGTACGCTATTCTATCTAAAAACATTCCACTACCTCAGGGT
ATACAGATGGGAGAGAAGGCTGGCGACACTGCTGCTG

BO06273.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG3988-PA 909 gammaSnap-RA 1..844 17..860 4170 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-RA 1117 CG3988-RA 71..941 17..887 4280 99.5 Plus
sei-RC 3197 CG3182-RC 137..384 777..530 1210 99.2 Minus
gammaSnap2-RA 1002 CG6208-RA 119..812 136..829 710 73.9 Plus
sei-RC 3197 CG3182-RC 446..520 534..460 375 100 Minus
sei-RC 3197 CG3182-RC 94..138 887..843 180 95.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 05:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24047504..24047861 887..530 1715 98.6 Minus
2R 25286936 2R 24048066..24048262 460..264 985 100 Minus
3R 32079331 3R 10120589..10121282 829..136 710 73.5 Minus
2R 25286936 2R 24048335..24048451 265..149 585 100 Minus
2R 25286936 2R 24047923..24047997 534..460 375 100 Minus
2R 25286936 2R 24048639..24048708 149..80 350 100 Minus
2R 25286936 2R 24048769..24048833 81..17 325 100 Minus
Blast to na_te.dros performed on 2015-02-11 05:02:54 has no hits.

BO06273.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:44:53 Download gff for BO06273.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3988-PA 1..871 17..887 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:15:53 Download gff for BO06273.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3988-PA 1..871 17..887 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:18:15 Download gff for BO06273.5prime
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 64..941 11..887 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:41:21 Download gff for BO06273.5prime
Subject Subject Range Query Range Percent Splice Strand
gammaSnap1-RA 64..941 11..887 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:41:21 Download gff for BO06273.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 24048769..24048840 11..81 95   Minus
2R 24048639..24048706 82..149 100 <- Minus
2R 24048335..24048450 150..265 100 <- Minus
2R 24048066..24048260 266..460 100 <- Minus
2R 24047926..24047996 461..531 100 <- Minus
2R 24047504..24047859 532..887 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:18:15 Download gff for BO06273.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19936292..19936363 11..81 95   Minus
arm_2R 19936162..19936229 82..149 100 <- Minus
arm_2R 19935858..19935973 150..265 100 <- Minus
arm_2R 19935589..19935783 266..460 100 <- Minus
arm_2R 19935449..19935519 461..531 100 <- Minus
arm_2R 19935027..19935382 532..887 98 <- Minus

BO06273.complete Sequence

940 bp (940 high quality bases) assembled on 2005-10-27

GenBank Submission: FJ630325

> BO06273.complete
GAAGTTATCAGTCGACATGTCGGGAATCGCTGCCAAAAAGATTGCCGAAG
CGGAGGACCTGGTGAAGCAGGCCGAGAAGAGCTTGAAGTTGTCCATGCTG
AAATGGGTTCCTGATTACGATAGTGCTGCGGATGAGTATTCCAAAGCTGC
CACTGCATATCGAATAGCTAAAAGTTATGATAAGAGCAAGGAGTGTTTTC
TGAAGGCAATCGACGCCTATAAAAACAACAAGTCTTGGTTCCATGCTGCA
AAGGCATACGAACAGATCATTTTGCTGTCAAAGGATGCCGATAAGCTACA
CGAAGTTGAGGAATACGCCAACAAATCGGCGAGTTTGTATCAACAGCACG
GTTCCCCAGAGGCAGCCGCATCCGCCTTGGATAAAGCCGCCAAGTTAACT
GAATCCAAGCATCCTGACATGGCTTTGCGCTTCTATCAGCATGCTCTAGA
AGTCATAATGATCGAGGATTCCGTCCGTCAAGCAGCCGAGTATGCATCAA
AAGTTTCCAGGATACTGGTCAAACTAAGGAGGTACGACGAAGCCACGAAT
GCGCTCAAAAAGGAGATCAGCTTGAATCAGCAAACGGAATCTTACGGACA
AATTGGACGCCTAGTTGTGGCCTTGGTGATGGTCCAACTGGCTCGCGGGG
ATTCCGTGGAAGCCGAAAAGACCTTCAGGGAGTGGGGAAACTGCTGCGAG
CCAGAGGAAGTGTCCACACTGCAGACCCTTCTGCAAGCCTTCGATGACGA
GGATCCCGAGTTAGCTGCTAGGATGCTGGCATCCCCATTCATACGACATA
TGGATGTTGAGTACGCTATTCTATCTAAAAACATTCCACTACCTCAGGGT
ATACAGATGGAGAAGAAGGCTGGCGACACTGCTGCTGAAACCAACGACGC
CGAGGACGAAGGTGGCTTGTGCGCAAGCTTTCTAGACCAT

BO06273.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-RA 909 CG3988-PA 1..906 17..922 4530 100 Plus
gammaSnap2-RA 852 CG6208-PA 93..786 136..829 725 73.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-RA 1117 CG3988-RA 71..976 17..922 4530 100 Plus
sei-RC 3197 CG3182-RC 137..384 777..530 1240 100 Minus
gammaSnap2-RA 1002 CG6208-RA 119..812 136..829 725 73.6 Plus
sei-RC 3197 CG3182-RC 446..520 534..460 375 100 Minus
sei-RC 3197 CG3182-RC 94..138 887..843 225 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24047504..24047861 887..530 1790 100 Minus
2R 25286936 2R 24048066..24048262 460..264 985 100 Minus
3R 32079331 3R 10120589..10121282 829..136 725 73.6 Minus
2R 25286936 2R 24048335..24048451 265..149 585 100 Minus
2R 25286936 2R 24047923..24047997 534..460 375 100 Minus
2R 25286936 2R 24048639..24048708 149..80 350 100 Minus
2R 25286936 2R 24048769..24048833 81..17 325 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:56:15 has no hits.

BO06273.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:25:02 Download gff for BO06273.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 1..909 17..926 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:49:33 Download gff for BO06273.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 50..971 11..933 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:12 Download gff for BO06273.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 71..976 17..924 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:25:03 Download gff for BO06273.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap-RA 50..971 11..933 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:06 Download gff for BO06273.complete
Subject Subject Range Query Range Percent Splice Strand
gammaSnap1-RA 71..976 17..924 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:06 Download gff for BO06273.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24048769..24048833 17..81 100   Minus
2R 24048639..24048706 82..149 100 <- Minus
2R 24048335..24048450 150..265 100 <- Minus
2R 24048066..24048260 266..460 100 <- Minus
2R 24047926..24047996 461..531 100 <- Minus
2R 24047505..24047859 532..886 100 <- Minus
2R 24047284..24047321 887..924 94 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:12 Download gff for BO06273.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19936292..19936356 17..81 100   Minus
arm_2R 19936162..19936229 82..149 100 <- Minus
arm_2R 19935858..19935973 150..265 100 <- Minus
arm_2R 19935589..19935783 266..460 100 <- Minus
arm_2R 19935449..19935519 461..531 100 <- Minus
arm_2R 19935028..19935382 532..886 100 <- Minus
arm_2R 19934807..19934844 887..924 94 <- Minus

BO06273.pep Sequence

Translation from 16 to 940

> BO06273.pep
MSGIAAKKIAEAEDLVKQAEKSLKLSMLKWVPDYDSAADEYSKAATAYRI
AKSYDKSKECFLKAIDAYKNNKSWFHAAKAYEQIILLSKDADKLHEVEEY
ANKSASLYQQHGSPEAAASALDKAAKLTESKHPDMALRFYQHALEVIMIE
DSVRQAAEYASKVSRILVKLRRYDEATNALKKEISLNQQTESYGQIGRLV
VALVMVQLARGDSVEAEKTFREWGNCCEPEEVSTLQTLLQAFDDEDPELA
ARMLASPFIRHMDVEYAILSKNIPLPQGIQMEKKAGDTAAETNDAEDEGG
LCASFLDH

BO06273.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
gammaSnap1-PA 302 CG3988-PA 1..302 1..302 1524 100 Plus
gammaSnap2-PA 283 CG6208-PA 1..282 1..290 991 67.3 Plus