Clone BO06485 Report

Search the DGRC for BO06485

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:64
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptProsalpha5-RA
Protein status:BO06485.pep: validated full length
Sequenced Size:766

Clone Sequence Records

BO06485.3prime Sequence

764 bp (763 high quality bases) assembled on 2005-12-03

> BO06485.3prime
ATGGTCTAGAAAGCTTGCCGCAATGTTCTTAATGTGCTGCTCCACCTCCT
CCTTGGTGAACATGTAGAACTCTCTTTCTTTCGTCATGGTCATCACCTCC
ACATTGGTGGAGTTTAGTTTCTCCTCCATAACCTGTTTAAGTGTGTTGAG
CGAAATGTCGATAGCCTCATCGAGAGTCAAATCGGGTCTAAATAAGTCCT
GCAGATTCTGCTGAGCACCTTCGCTGCCCGAGCCAATGGCCTTGGCTCCG
TGGCGCACGAATGTGCCGGAGGGATCCATGTGCCACAACTGGGGTTGTCC
CGCCTCGATGCCGGCAAATAGAATGGCCACACCAAAGGGACGACTCATGG
CGGCGGCACCATCGCTGTCGCCACTATCACCGAACTGGATGGCCAAAGTG
GACACAGCCTGGGCGCAGGACTCGATGGACATGCGCTCGTTGTAGACGAA
CCAGTGGTTCTGGCACTCCACGCGTGCCCTCTCGATCAGAGTCCTGGCAT
CGGCCATCAAGCCGGAGGTGGCGCAACCAATGTGCTTGTCCACCTCCACA
ATCTTCTCCACAGTACTGGGTACCATTAGCGGCGAAGTGATGCGCTTCTC
CACCGCCAAAACCACTCCTTCTGGCGTGCAAATTCCAATTGCTGTGGAGC
CCAATTTGATGGCCTCAATGGCATATTCCACTTGGAAGAGGCGGCCCTCC
GGCGAGAAGGTGTTCACGCCTCTGTCGTACTCGGAACGCGTGAGAAACAT
GTCGACTGATAACT

BO06485.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG10938-PA 735 ProsMA5-RA 1..732 750..19 3660 100 Minus
CG10938-PB 735 ProsMA5-RB 1..732 750..19 3660 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-RB 873 CG10938-RB 72..804 751..19 3665 100 Minus
Prosalpha5-RA 884 CG10938-RA 83..815 751..19 3665 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17413100..17413700 619..19 3005 100 Minus
2R 25286936 2R 17412910..17413044 751..617 675 100 Minus
Blast to na_te.dros performed on 2015-02-13 06:13:18 has no hits.

BO06485.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:50:59 Download gff for BO06485.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10938-PA 1..735 15..750 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:24:13 Download gff for BO06485.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10938-PB 1..735 15..750 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 18:00:26 Download gff for BO06485.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 80..820 13..758 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:16:55 Download gff for BO06485.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 80..820 13..758 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:16:55 Download gff for BO06485.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 17413102..17413705 13..617 99   Minus
2R 17412897..17413043 618..764 96 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 18:00:26 Download gff for BO06485.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13300607..13301210 13..617 99   Minus
arm_2R 13300402..13300548 618..764 96 -> Minus

BO06485.5prime Sequence

764 bp (686 high quality bases) assembled on 2005-12-03

> BO06485.5prime
GAAGTTATCAGTCGACATGTTTCTCACGCGTTCCGAGTACGACAGAGGCG
TGAACACCTTCTCGCCGGAGGGCCGCCTCTTCCAAGTGGAATATGCCATT
GAGGCCATCAAATTGGGCTCCACAGCAATTGGAATTTGCACGCCAGAAGG
AGTGGTTTTGGCGGTGGAGAAGCGCATCACTTCGCCGCTAATGGTACCCA
GTACTGTGGAGAAGATTGTGGAGGTGGACAAGCACATTGGTTGCGCCACC
TCCGGCTTGATGGCCGATGCCAGGACTCTGATCGAGAGGGCACGCGTGGA
GTGCCAGAACCACTGGTTCGTCTACAACGAGCGCATGTCCATCGAGTCCT
GCGCCCAGGCTGTGTCCACTTTGGCCATCCAGTTCGGTGATAGTGGCGAC
AGCGATGGTGCCGCCGCCATGAGTCGTCCCTTTGGTGTGGCCATTCTATT
TGCCGGCATCGAGGCGGGACAACCCCAGTTGTGGCACATGGATCCCTCCG
GCACATTCGTGCGCCACGGAGCCAAGGCCATTGGCTCGGGCAGCGAAGGT
GCTCAGCAGAATCTGCAGGACTTATTTAGACCCGATTTGACTCTCGATGA
GGCTATCGACATTTCGCTCAACACACTTAAACAGGTTATGGAGGAGAAAC
TAAACTCCACCAATGTGGAGGTGATGACCATGACGAAAGAAAGAGAGTTC
TACATGTTCACCAAGGAGGAGGTGGAGCAGCACATTAAGAACATTGCGGC
AAGCTTTCTAGACC

BO06485.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG10938-PA 735 ProsMA5-RA 1..732 17..748 3660 100 Plus
CG10938-PB 735 ProsMA5-RB 1..732 17..748 3660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-RB 873 CG10938-RB 72..804 16..748 3665 100 Plus
Prosalpha5-RA 884 CG10938-RA 83..815 16..748 3665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17413100..17413700 148..748 3005 100 Plus
2R 25286936 2R 17412910..17413044 16..150 675 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:49:56 has no hits.

BO06485.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:51:00 Download gff for BO06485.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10938-PA 1..735 17..752 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:24:14 Download gff for BO06485.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10938-PB 1..735 17..752 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:00:38 Download gff for BO06485.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 80..820 9..754 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:13:08 Download gff for BO06485.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 80..820 9..754 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:13:08 Download gff for BO06485.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 17413102..17413705 150..754 99   Plus
2R 17412896..17413043 2..149 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:00:38 Download gff for BO06485.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13300607..13301210 150..754 99   Plus
arm_2R 13300401..13300548 2..149 96 -> Plus

BO06485.complete Sequence

766 bp (766 high quality bases) assembled on 2005-10-27

GenBank Submission: FJ630421

> BO06485.complete
GAAGTTATCAGTCGACATGTTTCTCACGCGTTCCGAGTACGACAGAGGCG
TGAACACCTTCTCGCCGGAGGGCCGCCTCTTCCAAGTGGAATATGCCATT
GAGGCCATCAAATTGGGCTCCACAGCAATTGGAATTTGCACGCCAGAAGG
AGTGGTTTTGGCGGTGGAGAAGCGCATCACTTCGCCGCTAATGGTACCCA
GTACTGTGGAGAAGATTGTGGAGGTGGACAAGCACATTGGTTGCGCCACC
TCCGGCTTGATGGCCGATGCCAGGACTCTGATCGAGAGGGCACGCGTGGA
GTGCCAGAACCACTGGTTCGTCTACAACGAGCGCATGTCCATCGAGTCCT
GCGCCCAGGCTGTGTCCACTTTGGCCATCCAGTTCGGTGATAGTGGCGAC
AGCGATGGTGCCGCCGCCATGAGTCGTCCCTTTGGTGTGGCCATTCTATT
TGCCGGCATCGAGGCGGGACAACCCCAGTTGTGGCACATGGATCCCTCCG
GCACATTCGTGCGCCACGGAGCCAAGGCCATTGGCTCGGGCAGCGAAGGT
GCTCAGCAGAATCTGCAGGACTTATTTAGACCCGATTTGACTCTCGATGA
GGCTATCGACATTTCGCTCAACACACTTAAACAGGTTATGGAGGAGAAAC
TAAACTCCACCAATGTGGAGGTGATGACCATGACGAAAGAAAGAGAGTTC
TACATGTTCACCAAGGAGGAGGTGGAGCAGCACATTAAGAACATTGCGGC
AAGCTTTCTAGACCAT

BO06485.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-RB 735 CG10938-PB 1..732 17..748 3660 100 Plus
Prosalpha5-RA 735 CG10938-PA 1..732 17..748 3660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-RB 873 CG10938-RB 72..804 16..748 3665 100 Plus
Prosalpha5-RA 884 CG10938-RA 83..815 16..748 3665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17413100..17413700 148..748 3005 100 Plus
2R 25286936 2R 17412910..17413044 16..150 675 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:54:10 has no hits.

BO06485.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:23:12 Download gff for BO06485.complete
Subject Subject Range Query Range Percent Splice Strand
ProsMA5-RB 1..735 17..752 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:47:04 Download gff for BO06485.complete
Subject Subject Range Query Range Percent Splice Strand
ProsMA5-RB 58..809 2..754 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:02:02 Download gff for BO06485.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 90..815 23..750 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:23:13 Download gff for BO06485.complete
Subject Subject Range Query Range Percent Splice Strand
ProsMA5-RB 58..809 2..754 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:28:42 Download gff for BO06485.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 90..815 23..750 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:28:42 Download gff for BO06485.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17413102..17413700 150..750 99   Plus
2R 17412917..17413043 23..149 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:02:02 Download gff for BO06485.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13300607..13301205 150..750 99   Plus
arm_2R 13300422..13300548 23..149 100 -> Plus

BO06485.pep Sequence

Translation from 16 to 766

> BO06485.pep
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAV
EKRITSPLMVPSTVEKIVEVDKHIGCATSGLMADARTLIERARVECQNHW
FVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEA
GQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDIS
LNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNIAASFLDH

BO06485.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-PB 244 CG10938-PB 1..244 1..244 1244 100 Plus
Prosalpha5-PA 244 CG10938-PA 1..244 1..244 1244 100 Plus
Prosalpha2-PA 234 CG5266-PA 1..210 3..219 342 33.2 Plus
Prosalpha4-PA 249 CG3422-PA 3..234 6..243 335 33.6 Plus
Prosalpha4T1-PA 249 CG17268-PA 3..232 6..241 315 32.2 Plus