Clone BO06554 Report

Search the DGRC for BO06554

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:65
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptAnnX-RA
Protein status:BO06554.pep: validated full length
Sequenced Size:994

Clone Sequence Records

BO06554.3prime Sequence

922 bp (794 high quality bases) assembled on 2005-12-03

> BO06554.3prime
ATGGTCTAGAAAGCTTGCGGCGGATCCAAGTAGGGCTGTCAGGGCCCGCT
TGTAGTCACCAGAGGTCTCCGCCACCACGGCGCTGTGCAGCGTACGGTTG
TAGATCCGCTCGAACTCCTGCTTAATGGTCTCCAGGTCGATCTCCGAGCG
GCTGACGATGATGCGGATGAGCGTGGCGTCATCGGTGCCGGCGCCATTCA
TGGCCTTGTACAGGCGGTTGGCGAAGAAGGCCGCCGGTGACTGGACGCAC
TCAACTATGGCCATCATGGCCTCGTGCAGCTCGTCGGACATCTCGTGCTT
GATGGCCTGCTCGATGGTCTGCCCGGAGAGCACCTTGTACTCCTCGAAGA
CGAGTCGCAGCTGCGGGAAGCTGGCGTGCGACATGATCCGGTTGAAGACC
TCCTCGTCCGTTCCCAGCTTGGCCTCGCCGGCCGAGTAGAGCTGGGCGGC
CTGCTCCTTGGCCTGACCGACGTCGACGGGCGTGTCCAGTCCGTCACGTA
CTCCGGTCACGATCAGCGTGAGCAGGCGGCGGAAAAAGCCGGAGGTCTCG
CTGCACATCTGCTCGGCCAGCGGGCGCTGGTAGCGCTCCTCGTAGACGGC
CACGATCTGGGCCATCTCCTCGTTGGTCTTGGTGCACAGGATCTCGACGA
GCGTGGCCTCCTCGGTTCCGATGCCCGCCATGGCGGCGTGCAGTTGCTTG
CACAGGTACTCCACTGGTGGCATCATTAGACCCACGATCACGTCCTCGAA
CTTGCCTCCCAGCTCGTCCTTAAGATCGTCCACCAGGTCGCGCTCGAACT
CCGCTTCGTAAACCGCCTTGATCGTCTGCCTCTGCTGGTTGCTCCTGCCG
ACGAGCACGTCGATGATTTCCTGCTCGTCGGTGCCAAATCCCTTCATCGC
CGCCCGCAGCACCTGGGCGTCC

BO06554.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9579-PA 963 AnnX-RA 57..960 922..19 4495 99.8 Minus
CG33491-PA 369 CG33491-RA 1..366 384..19 1805 99.7 Minus
CG33487-PA 369 CG33487-RA 1..366 384..19 1780 99.4 Minus
CG33496-PA 369 CG33496-RA 1..366 384..19 1780 99.4 Minus
CG33498-PA 366 CG33498-RA 1..310 384..75 1525 99.6 Minus
CG33498-PA 366 CG33498-RA 307..363 75..19 285 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 03:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-RA 1244 CG9579-RA 191..1094 922..19 4505 99.9 Minus
AnxB10-RB 1247 CG9579-RB 191..1097 922..19 4465 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 03:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20172305..20172972 255..922 3325 99.9 Plus
X 23542271 X 20187343..20187594 255..506 1230 99.2 Plus
X 23542271 X 20179468..20179717 255..504 1220 99.2 Plus
X 23542271 X 20195077..20195326 255..504 1220 99.2 Plus
X 23542271 X 20202793..20203042 255..504 1220 99.2 Plus
X 23542271 X 20210463..20210712 255..504 1220 99.2 Plus
X 23542271 X 20218115..20218364 255..504 1220 99.2 Plus
X 23542271 X 20225850..20226099 255..504 1220 99.2 Plus
X 23542271 X 20172040..20172225 72..257 930 100 Plus
X 23542271 X 20179203..20179388 72..257 930 100 Plus
X 23542271 X 20194808..20194993 72..257 930 100 Plus
X 23542271 X 20202524..20202709 72..257 930 100 Plus
X 23542271 X 20210194..20210379 72..257 930 100 Plus
X 23542271 X 20187078..20187263 72..257 915 99.5 Plus
X 23542271 X 20217850..20218035 72..257 915 99.5 Plus
X 23542271 X 20225585..20225770 72..257 915 99.5 Plus
X 23542271 X 20171595..20171649 19..73 275 100 Plus
X 23542271 X 20178758..20178812 19..73 275 100 Plus
X 23542271 X 20186633..20186687 19..73 275 100 Plus
X 23542271 X 20194363..20194417 19..73 275 100 Plus
X 23542271 X 20202079..20202133 19..73 275 100 Plus
X 23542271 X 20209749..20209803 19..73 275 100 Plus
X 23542271 X 20217405..20217459 19..73 275 100 Plus
X 23542271 X 20225140..20225194 19..73 275 100 Plus
Blast to na_te.dros performed on 2015-02-11 03:13:15 has no hits.

BO06554.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:52:56 Download gff for BO06554.3prime
Subject Subject Range Query Range Percent Splice Strand
AnnX-PA 57..963 18..922 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:26:49 Download gff for BO06554.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9579-PA 57..963 18..922 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:53:15 Download gff for BO06554.3prime
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 191..1099 13..922 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:40:03 Download gff for BO06554.3prime
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 191..1099 13..922 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:40:03 Download gff for BO06554.3prime
Subject Subject Range Query Range Percent Splice Strand
X 20172305..20172972 255..922 99   Plus
X 20172041..20172222 73..254 100 <- Plus
X 20171590..20171648 13..72 95 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:53:15 Download gff for BO06554.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20066338..20067005 255..922 99   Plus
arm_X 20066074..20066255 73..254 100 <- Plus
arm_X 20065623..20065681 13..72 95 <- Plus

BO06554.5prime Sequence

911 bp (787 high quality bases) assembled on 2005-12-03

> BO06554.5prime
GAAGTTATCAGTCGACATGGAATACAAACCCGTGCCCACGGTTAAGGACG
CAGCTCCCTTCGACGCCTCCCAGGACGCCCAGGTGCTGCGGGCGGCGATG
AAGGGATTCGGCACCGACGAGCAGGAAATCATCGACGTGCTCGTCGGCAG
GAGCAACCAGCAGAGGCAGACGATCAAGGCGGTTTACGAAGCGGAGTTCG
AGCGCGACCTGGTGGACGATCTTAAGGACGAGCTGGGAGGCAAGTTCGAG
GACGTGATCGTGGGTCTAATGATGCCACCAGTGGAGTACCTGTGCAAGCA
ACTGCACGCCGCCATGGCGGGCATCGGAACCGAGGAGGCCACGCTCGTCG
AGATCCTGTGCACCAAGACCAACGAGGAGATGGCCCAGATCGTGGCCGTC
TACGAGGAGCGCTACCAGCGCCCGCTGGCCGAGCAGATGTGCAGCGAGAC
CTCCGGCTTTTTCCGCCGCCTGCTCACGCTGATCGTGACCGGAGTACGTG
ACGGACTGGACACGCCCGTCGACGTCGGTCAGGCCAAGGAGCAGGCCGCC
CAGCTCTACTCGGCCGGCGAGGCCAAGCTGGGAACGGACGAGGAGGTCTT
CAACCGGATCATGTCGCACGCCAGCTTCCCGCAGCTGCGACTCGTCTTCG
AGGAGTACAAGGTGCTCTCCGGGCAGACCATCGAGCAGGCCATCAAGCAC
GAGATGTCCGACGAGCTGCACGAGGCCATGATGGCCATAGTTGAGTGCGT
CCAGTCACCGGCGGCCTTCTTCGCCAACCGCCTGTACAAGGCCATGAATG
GCGCCGGCACCGATGACGCCACGCTCATCCGCATCATCGTCAGCCGCTCG
GAGATCGACCTGGAGACCATTAAGCAGGAGTTCGAGCGGATCTACACCGT
ACGCTGCACAG

BO06554.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9579-PA 963 AnnX-RA 1..880 17..896 4400 100 Plus
CG33498-PA 366 CG33498-RA 1..286 611..896 1405 99.6 Plus
CG33491-PA 369 CG33491-RA 1..286 611..896 1405 99.6 Plus
CG33487-PA 369 CG33487-RA 1..286 611..896 1380 99.3 Plus
CG33496-PA 369 CG33496-RA 1..286 611..896 1380 99.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-RB 1247 CG9579-RB 135..1030 17..911 4455 99.9 Plus
AnxB10-RA 1244 CG9579-RA 135..1030 17..911 4455 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20172305..20173016 740..29 3560 100 Minus
X 23542271 X 20187343..20187594 740..489 1230 99.2 Minus
X 23542271 X 20179468..20179717 740..491 1220 99.2 Minus
X 23542271 X 20195077..20195326 740..491 1220 99.2 Minus
X 23542271 X 20202793..20203042 740..491 1220 99.2 Minus
X 23542271 X 20210463..20210712 740..491 1220 99.2 Minus
X 23542271 X 20218115..20218364 740..491 1220 99.2 Minus
X 23542271 X 20225850..20226099 740..491 1220 99.2 Minus
X 23542271 X 20172051..20172225 911..738 825 99.4 Minus
X 23542271 X 20179214..20179388 911..738 825 99.4 Minus
X 23542271 X 20194819..20194993 911..738 825 99.4 Minus
X 23542271 X 20202535..20202709 911..738 825 99.4 Minus
X 23542271 X 20210205..20210379 911..738 825 99.4 Minus
X 23542271 X 20187089..20187263 911..738 810 98.9 Minus
X 23542271 X 20217861..20218035 911..738 810 98.9 Minus
X 23542271 X 20225596..20225770 911..738 810 98.9 Minus
Blast to na_te.dros performed on 2015-02-10 15:55:22 has no hits.

BO06554.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:52:57 Download gff for BO06554.5prime
Subject Subject Range Query Range Percent Splice Strand
AnnX-PA 1..896 17..911 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:26:51 Download gff for BO06554.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9579-PA 1..896 17..911 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:01:00 Download gff for BO06554.5prime
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 131..1030 9..911 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:13:51 Download gff for BO06554.5prime
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 131..1030 9..911 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:13:51 Download gff for BO06554.5prime
Subject Subject Range Query Range Percent Splice Strand
X 20172305..20173016 29..740 100 <- Minus
X 20172051..20172222 741..911 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:01:00 Download gff for BO06554.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20066338..20067049 29..740 100 <- Minus
arm_X 20066084..20066255 741..911 99 <- Minus

BO06554.complete Sequence

994 bp (994 high quality bases) assembled on 2005-10-27

GenBank Submission: FJ630444

> BO06554.complete
GAAGTTATCAGTCGACATGGAATACAAACCCGTGCCCACGGTTAAGGACG
CAGCTCCCTTCGACGCCTCCCAGGACGCCCAGGTGCTGCGGGCGGCGATG
AAGGGATTCGGCACCGACGAGCAGGAAATCATCGACGTGCTCGTCGGCAG
GAGCAACCAGCAGAGGCAGACGATCAAGGCGGTTTACGAAGCGGAGTTCG
AGCGCGACCTGGTGGACGATCTTAAGGACGAGCTGGGAGGCAAGTTCGAG
GACGTGATCGTGGGTCTAATGATGCCACCAGTGGAGTACCTGTGCAAGCA
ACTGCACGCCGCCATGGCGGGCATCGGAACCGAGGAGGCCACGCTCGTCG
AGATCCTGTGCACCAAGACCAACGAGGAGATGGCCCAGATCGTGGCCGTC
TACGAGGAGCGCTACCAGCGCCCGCTGGCCGAGCAGATGTGCAGCGAGAC
CTCCGGCTTTTTCCGCCGCCTGCTCACGCTGATCGTGACCGGAGTACGTG
ACGGACTGGACACGCCCGTCGACGTCGGTCAGGCCAAGGAGCAGGCCGCC
CAGCTCTACTCGGCCGGCGAGGCCAAGCTGGGAACGGACGAGGAGGTCTT
CAACCGGATCATGTCGCACGCCAGCTTCCCGCAGCTGCGACTCGTCTTCG
AGGAGTACAAGGTGCTCTCCGGGCAGACCATCGAGCAGGCCATCAAGCAC
GAGATGTCCGACGAGCTGCACGAGGCCATGATGGCCATAGTTGAGTGCGT
CCAGTCACCGGCGGCCTTCTTCGCCAACCGCCTGTACAAGGCCATGAATG
GCGCCGGCACCGATGACGCCACGCTCATCCGCATCATCGTCAGCCGCTCG
GAGATCGACCTGGAGACCATTAAGCAGGAGTTCGAGCGGATCTACAACCG
TACGCTGCACAGCGCCGTGGTGGCGGAGACCTCTGGTGACTACAAGCGGG
CCCTGACAGCCCTACTTGGATCCGCCGCAAGCTTTCTAGACCAT

BO06554.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-RA 963 CG9579-PA 1..960 17..976 4800 100 Plus
AnxB10-RB 966 CG9579-PB 1..963 17..976 4735 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-RA 1244 CG9579-RA 135..1094 17..976 4800 100 Plus
AnxB10-RB 1247 CG9579-RB 135..1097 17..976 4735 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20172305..20173016 740..29 3560 100 Minus
X 23542271 X 20187343..20187594 740..489 1230 99.2 Minus
X 23542271 X 20179468..20179717 740..491 1220 99.2 Minus
X 23542271 X 20195077..20195326 740..491 1220 99.2 Minus
X 23542271 X 20202793..20203042 740..491 1220 99.2 Minus
X 23542271 X 20210463..20210712 740..491 1220 99.2 Minus
X 23542271 X 20218115..20218364 740..491 1220 99.2 Minus
X 23542271 X 20225850..20226099 740..491 1220 99.2 Minus
X 23542271 X 20172040..20172225 923..738 930 100 Minus
X 23542271 X 20179203..20179388 923..738 930 100 Minus
X 23542271 X 20194808..20194993 923..738 930 100 Minus
X 23542271 X 20202524..20202709 923..738 930 100 Minus
X 23542271 X 20210194..20210379 923..738 930 100 Minus
X 23542271 X 20187078..20187263 923..738 915 99.5 Minus
X 23542271 X 20217850..20218035 923..738 915 99.5 Minus
X 23542271 X 20225585..20225770 923..738 915 99.5 Minus
X 23542271 X 20171595..20171649 976..922 275 100 Minus
X 23542271 X 20178758..20178812 976..922 275 100 Minus
X 23542271 X 20186633..20186687 976..922 275 100 Minus
X 23542271 X 20194363..20194417 976..922 275 100 Minus
X 23542271 X 20202079..20202133 976..922 275 100 Minus
X 23542271 X 20209749..20209803 976..922 275 100 Minus
X 23542271 X 20217405..20217459 976..922 275 100 Minus
X 23542271 X 20225140..20225194 976..922 275 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:22:10 has no hits.

BO06554.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:22:54 Download gff for BO06554.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 1..963 17..977 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:46:43 Download gff for BO06554.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 136..1104 9..982 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:13:17 Download gff for BO06554.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 135..1094 17..978 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:22:54 Download gff for BO06554.complete
Subject Subject Range Query Range Percent Splice Strand
AnnX-RA 136..1104 9..982 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:09:12 Download gff for BO06554.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB10-RA 135..1094 17..978 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:09:12 Download gff for BO06554.complete
Subject Subject Range Query Range Percent Splice Strand
X 20172305..20173016 29..740 100 <- Minus
X 20172041..20172222 741..922 100 <- Minus
X 20171593..20171648 923..978 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:13:17 Download gff for BO06554.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20066338..20067049 29..740 100 <- Minus
arm_X 20066074..20066255 741..922 100 <- Minus
arm_X 20065626..20065681 923..978 96 <- Minus

BO06554.pep Sequence

Translation from 16 to 994

> BO06554.pep
MEYKPVPTVKDAAPFDASQDAQVLRAAMKGFGTDEQEIIDVLVGRSNQQR
QTIKAVYEAEFERDLVDDLKDELGGKFEDVIVGLMMPPVEYLCKQLHAAM
AGIGTEEATLVEILCTKTNEEMAQIVAVYEERYQRPLAEQMCSETSGFFR
RLLTLIVTGVRDGLDTPVDVGQAKEQAAQLYSAGEAKLGTDEEVFNRIMS
HASFPQLRLVFEEYKVLSGQTIEQAIKHEMSDELHEAMMAIVECVQSPAA
FFANRLYKAMNGAGTDDATLIRIIVSRSEIDLETIKQEFERIYNRTLHSA
VVAETSGDYKRALTALLGSAASFLDH

BO06554.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB10-PA 320 CG9579-PA 1..320 1..320 1604 100 Plus
AnxB10-PB 321 CG9579-PB 1..321 1..320 1592 99.7 Plus
AnxB11-PF 322 CG9968-PF 7..321 7..322 752 48.1 Plus
AnxB11-PC 322 CG9968-PC 7..321 7..322 752 48.1 Plus
AnxB11-PA 322 CG9968-PA 7..321 7..322 752 48.1 Plus
AnxB10-PA 320 CG9579-PA 19..165 176..325 156 26.7 Plus
AnxB10-PB 321 CG9579-PB 19..165 176..325 156 26.7 Plus