Clone BO06566 Report

Search the DGRC for BO06566

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:65
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG8386-RA
Protein status:BO06566.pep: validated full length
Sequenced Size:526

Clone Sequence Records

BO06566.3prime Sequence

524 bp (523 high quality bases) assembled on 2005-12-03

> BO06566.3prime
ATGGTCTAGAAAGCTTGCCTTTTCCTTGTACGTAATGATTCCCTTCTCGA
TGAGATCCGGAATCTCCACGGCCAGCCAGGGAGCAAGACCCAGAGCCATA
GCGTGGGCGATCCCAAACTTGGGAACATTGCGTGCCCACAGTGGCTTAAA
GTGATCCGTCAGACAGATCTTGCCACCACGGTACATCTTCGCTGTCTTGC
CGTCAAGTTCTGGCAGGGCAATCTCGGGCGCGGTGGTTGGGTACGTCACT
GGAATGTCGAACTCCACGTCGAACTCGTACTTTAACAGGTTGTGCATGTA
CCAACACTTTCCGAACCACTTGGTGCCCTCCTTGTTGGATTCCAGACGGA
ACCAGTCGCTGCCGGACTGTTTGTTGTTCTCCACATACTTAATTAGTGCC
TGGTACTCCTCCTTGAGCCGCTGCACCCACACATCCTTTTCGCGCGGACC
AGCGCGAATCTGCAGCAGCGGAATGTTGCTCAACGTTTTTCGAGTGCTGT
CGTCCACCATGTCGACTGATAACT

BO06566.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-PA 495 CG8386-RA 1..492 510..19 2460 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-RA 656 CG8386-RA 97..592 514..19 2465 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16007087..16007388 88..389 1510 100 Plus
2R 25286936 2R 16007445..16007571 388..514 620 99.2 Plus
2R 25286936 2R 16006957..16007025 19..87 345 100 Plus
Blast to na_te.dros performed on 2015-02-11 22:53:36 has no hits.

BO06566.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:53:19 Download gff for BO06566.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-PA 1..495 18..510 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:27:19 Download gff for BO06566.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-PA 1..495 18..510 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:44:44 Download gff for BO06566.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 88..601 8..522 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:46:54 Download gff for BO06566.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 88..601 8..522 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:46:54 Download gff for BO06566.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 16007445..16007578 388..522 96   Plus
2R 16007087..16007386 88..387 100 <- Plus
2R 16006948..16007025 8..87 93 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:44:44 Download gff for BO06566.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11894950..11895083 388..522 96   Plus
arm_2R 11894592..11894891 88..387 100 <- Plus
arm_2R 11894453..11894530 8..87 93 <- Plus

BO06566.5prime Sequence

524 bp (523 high quality bases) assembled on 2005-12-03

> BO06566.5prime
GAAGTTATCAGTCGACATGGTGGACGACAGCACTCGAAAAACGTTGAGCA
ACATTCCGCTGCTGCAGATTCGCGCTGGTCCGCGCGAAAAGGATGTGTGG
GTGCAGCGGCTCAAGGAGGAGTACCAGGCACTAATTAAGTATGTGGAGAA
CAACAAACAGTCCGGCAGCGACTGGTTCCGTCTGGAATCCAACAAGGAGG
GCACCAAGTGGTTCGGAAAGTGTTGGTACATGCACAACCTGTTAAAGTAC
GAGTTCGACGTGGAGTTCGACATTCCAGTGACGTACCCAACCACCGCGCC
CGAGATTGCCCTGCCAGAACTTGACGGCAAGACAGCGAAGATGTACCGTG
GTGGCAAGATCTGTCTGACGGATCACTTTAAGCCACTGTGGGCACGCAAT
GTTCCCAAGTTTGGGATCGCCCACGCTATGGCTCTGGGTCTTGCTCCCTG
GCTGGCCGTGGAGATTCCGGATCTCATCGAGAAGGGAATCATTACGTACA
AGGAAAAGGCAAGCTTTCTAGACC

BO06566.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-PA 495 CG8386-RA 1..492 17..508 2460 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-RA 656 CG8386-RA 97..592 13..508 2465 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16007087..16007388 439..138 1510 100 Minus
2R 25286936 2R 16007445..16007571 139..13 620 99.2 Minus
2R 25286936 2R 16006957..16007025 508..440 345 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:03:06 has no hits.

BO06566.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:53:20 Download gff for BO06566.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-PA 1..495 17..509 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:27:20 Download gff for BO06566.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-PA 1..495 17..509 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:08:12 Download gff for BO06566.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 88..601 5..519 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:45:58 Download gff for BO06566.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 88..601 5..519 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:45:58 Download gff for BO06566.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 16007445..16007578 5..139 96   Minus
2R 16007087..16007386 140..439 100 <- Minus
2R 16006948..16007025 440..519 93 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:08:12 Download gff for BO06566.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11894950..11895083 5..139 96   Minus
arm_2R 11894592..11894891 140..439 100 <- Minus
arm_2R 11894453..11894530 440..519 93 <- Minus

BO06566.complete Sequence

526 bp (526 high quality bases) assembled on 2005-10-27

GenBank Submission: FJ638640

> BO06566.complete
GAAGTTATCAGTCGACATGGTGGACGACAGCACTCGAAAAACGTTGAGCA
ACATTCCGCTGCTGCAGATTCGCGCTGGTCCGCGCGAAAAGGATGTGTGG
GTGCAGCGGCTCAAGGAGGAGTACCAGGCACTAATTAAGTATGTGGAGAA
CAACAAACAGTCCGGCAGCGACTGGTTCCGTCTGGAATCCAACAAGGAGG
GCACCAAGTGGTTCGGAAAGTGTTGGTACATGCACAACCTGTTAAAGTAC
GAGTTCGACGTGGAGTTCGACATTCCAGTGACGTACCCAACCACCGCGCC
CGAGATTGCCCTGCCAGAACTTGACGGCAAGACAGCGAAGATGTACCGTG
GTGGCAAGATCTGTCTGACGGATCACTTTAAGCCACTGTGGGCACGCAAT
GTTCCCAAGTTTGGGATCGCCCACGCTATGGCTCTGGGTCTTGCTCCCTG
GCTGGCCGTGGAGATTCCGGATCTCATCGAGAAGGGAATCATTACGTACA
AGGAAAAGGCAAGCTTTCTAGACCAT

BO06566.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-RA 495 CG8386-PA 1..492 17..508 2460 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-RA 656 CG8386-RA 97..592 13..508 2465 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16007087..16007388 439..138 1510 100 Minus
2R 25286936 2R 16007445..16007571 139..13 620 99.2 Minus
2R 25286936 2R 16006957..16007025 508..440 345 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:34:28 has no hits.

BO06566.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:22:39 Download gff for BO06566.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 1..495 17..509 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:05:11 Download gff for BO06566.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 76..589 5..519 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:02:30 Download gff for BO06566.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 101..592 17..510 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:22:40 Download gff for BO06566.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 76..589 5..519 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:04:47 Download gff for BO06566.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 101..592 17..510 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:04:47 Download gff for BO06566.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16007445..16007567 17..139 100   Minus
2R 16007087..16007386 140..439 100 <- Minus
2R 16006953..16007025 440..510 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:02:30 Download gff for BO06566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11894950..11895072 17..139 100   Minus
arm_2R 11894592..11894891 140..439 100 <- Minus
arm_2R 11894458..11894530 440..510 97 <- Minus

BO06566.pep Sequence

Translation from 16 to 526

> BO06566.pep
MVDDSTRKTLSNIPLLQIRAGPREKDVWVQRLKEEYQALIKYVENNKQSG
SDWFRLESNKEGTKWFGKCWYMHNLLKYEFDVEFDIPVTYPTTAPEIALP
ELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGIAHAMALGLAPWLAVEI
PDLIEKGIITYKEKASFLDH

BO06566.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-PA 164 CG8386-PA 1..164 1..164 887 100 Plus