Clone BO06570 Report

Search the DGRC for BO06570

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:65
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG7375-RA
Protein status:BO06570.pep: validated full length
Sequenced Size:577

Clone Sequence Records

BO06570.3prime Sequence

575 bp (574 high quality bases) assembled on 2005-12-03

> BO06570.3prime
ATGGTCTAGAAAGCTTGCCTTGAGCAGACAGCACTCGAAGTAGGTCTCGC
CCACACAGCCACCACGCATCGCCTTCTTTACATTGTTCTCGAACTGACGG
CGGTTGGTCTGCAGGACGTCGGCCGCCTCCTTGTTGAGCGGATCCTCGGG
ATTGGGTTCCAAGAATAGAAACTGCAAGCCATAGACGATGGAGTTGATGT
TCAGCACTGGATTCCAGTCCTCGCGCAGAATGTTGAGGCAGACGTTGCCA
TCCAGGTCAATATTGGGATGGTACACCTGGGTGGCGCACTTCACCTTGGG
CGGCTCGTGCGGATAGTTGGATCCGACGCGGAAATTGAACACGAAGCGCC
CGTCTCTGTAGAAGCCCTCGTCGGGCGAGATGATAAGCTTGAAGTTGAGC
AAGTCATTGGGATCGGGAAAGTCTGTGGCGCAAGTGTTTGGCAGGTTCAG
TTCGTTAATATCTTTCTGTATGCGCAGCTGGGCGGCGGACGCTTTCTTCT
GCTGACTGCCCTTTTGCTCGCCGTCTTTCTTCTGCTGCTTAAGCGTGAAT
AGTTTAATCATGTCGACTGATAACT

BO06570.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7375-PA 546 CG7375-RA 1..543 561..19 2715 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-RC 1729 CG7375-RC 291..833 561..19 2715 100 Minus
UbcE2M-RB 916 CG7375-RB 164..706 561..19 2715 100 Minus
UbcE2M-RA 913 CG7375-RA 161..703 561..19 2715 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8197141..8197445 159..463 1525 100 Plus
3L 28110227 3L 8196743..8196884 19..160 710 100 Plus
3L 28110227 3L 8197522..8197621 462..561 500 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:22:03 has no hits.

BO06570.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:53:26 Download gff for BO06570.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7375-PA 1..546 16..561 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:27:29 Download gff for BO06570.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7375-PA 1..546 16..561 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:17:17 Download gff for BO06570.3prime
Subject Subject Range Query Range Percent Splice Strand
Ubc12-RA 161..703 19..561 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:11:56 Download gff for BO06570.3prime
Subject Subject Range Query Range Percent Splice Strand
UbcE2M-RA 161..703 19..561 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:11:56 Download gff for BO06570.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8197522..8197621 462..561 100   Plus
3L 8197142..8197443 160..461 100 <- Plus
3L 8196743..8196883 19..159 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:17:17 Download gff for BO06570.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8190622..8190721 462..561 100   Plus
arm_3L 8190242..8190543 160..461 100 <- Plus
arm_3L 8189843..8189983 19..159 100 <- Plus

BO06570.5prime Sequence

575 bp (574 high quality bases) assembled on 2005-12-03

> BO06570.5prime
GAAGTTATCAGTCGACATGATTAAACTATTCACGCTTAAGCAGCAGAAGA
AAGACGGCGAGCAAAAGGGCAGTCAGCAGAAGAAAGCGTCCGCCGCCCAG
CTGCGCATACAGAAAGATATTAACGAACTGAACCTGCCAAACACTTGCGC
CACAGACTTTCCCGATCCCAATGACTTGCTCAACTTCAAGCTTATCATCT
CGCCCGACGAGGGCTTCTACAGAGACGGGCGCTTCGTGTTCAATTTCCGC
GTCGGATCCAACTATCCGCACGAGCCGCCCAAGGTGAAGTGCGCCACCCA
GGTGTACCATCCCAATATTGACCTGGATGGCAACGTCTGCCTCAACATTC
TGCGCGAGGACTGGAATCCAGTGCTGAACATCAACTCCATCGTCTATGGC
TTGCAGTTTCTATTCTTGGAACCCAATCCCGAGGATCCGCTCAACAAGGA
GGCGGCCGACGTCCTGCAGACCAACCGCCGTCAGTTCGAGAACAATGTAA
AGAAGGCGATGCGTGGTGGCTGTGTGGGCGAGACCTACTTCGAGTGCTGT
CTGCTCAAGGCAAGCTTTCTAGACC

BO06570.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7375-PA 546 CG7375-RA 1..543 17..559 2715 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-RC 1729 CG7375-RC 291..833 17..559 2715 100 Plus
UbcE2M-RB 916 CG7375-RB 164..706 17..559 2715 100 Plus
UbcE2M-RA 913 CG7375-RA 161..703 17..559 2715 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 07:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8197141..8197445 419..115 1525 100 Minus
3L 28110227 3L 8196743..8196884 559..418 710 100 Minus
3L 28110227 3L 8197522..8197621 116..17 500 100 Minus
Blast to na_te.dros performed on 2015-02-12 07:00:15 has no hits.

BO06570.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:53:27 Download gff for BO06570.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7375-PA 1..546 17..562 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:27:31 Download gff for BO06570.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7375-PA 1..546 17..562 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:32:58 Download gff for BO06570.5prime
Subject Subject Range Query Range Percent Splice Strand
Ubc12-RA 161..703 17..559 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:39:43 Download gff for BO06570.5prime
Subject Subject Range Query Range Percent Splice Strand
UbcE2M-RA 161..703 17..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:39:43 Download gff for BO06570.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8197522..8197621 17..116 100   Minus
3L 8197142..8197443 117..418 100 <- Minus
3L 8196743..8196883 419..559 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:32:58 Download gff for BO06570.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8190622..8190721 17..116 100   Minus
arm_3L 8190242..8190543 117..418 100 <- Minus
arm_3L 8189843..8189983 419..559 100 <- Minus

BO06570.complete Sequence

577 bp (577 high quality bases) assembled on 2005-10-27

GenBank Submission: FJ630449

> BO06570.complete
GAAGTTATCAGTCGACATGATTAAACTATTCACGCTTAAGCAGCAGAAGA
AAGACGGCGAGCAAAAGGGCAGTCAGCAGAAGAAAGCGTCCGCCGCCCAG
CTGCGCATACAGAAAGATATTAACGAACTGAACCTGCCAAACACTTGCGC
CACAGACTTTCCCGATCCCAATGACTTGCTCAACTTCAAGCTTATCATCT
CGCCCGACGAGGGCTTCTACAGAGACGGGCGCTTCGTGTTCAATTTCCGC
GTCGGATCCAACTATCCGCACGAGCCGCCCAAGGTGAAGTGCGCCACCCA
GGTGTACCATCCCAATATTGACCTGGATGGCAACGTCTGCCTCAACATTC
TGCGCGAGGACTGGAATCCAGTGCTGAACATCAACTCCATCGTCTATGGC
TTGCAGTTTCTATTCTTGGAACCCAATCCCGAGGATCCGCTCAACAAGGA
GGCGGCCGACGTCCTGCAGACCAACCGCCGTCAGTTCGAGAACAATGTAA
AGAAGGCGATGCGTGGTGGCTGTGTGGGCGAGACCTACTTCGAGTGCTGT
CTGCTCAAGGCAAGCTTTCTAGACCAT

BO06570.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-RC 546 CG7375-PC 1..543 17..559 2715 100 Plus
UbcE2M-RB 546 CG7375-PB 1..543 17..559 2715 100 Plus
UbcE2M-RA 546 CG7375-PA 1..543 17..559 2715 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-RC 1729 CG7375-RC 291..833 17..559 2715 100 Plus
UbcE2M-RB 916 CG7375-RB 164..706 17..559 2715 100 Plus
UbcE2M-RA 913 CG7375-RA 161..703 17..559 2715 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8197141..8197445 419..115 1525 100 Minus
3L 28110227 3L 8196743..8196884 559..418 710 100 Minus
3L 28110227 3L 8197522..8197621 116..17 500 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:31:17 has no hits.

BO06570.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:22:42 Download gff for BO06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 1..546 17..562 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:46:26 Download gff for BO06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 160..702 17..559 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:26:11 Download gff for BO06570.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc12-RA 161..703 17..561 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:22:42 Download gff for BO06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG7375-RA 160..702 17..559 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:33:18 Download gff for BO06570.complete
Subject Subject Range Query Range Percent Splice Strand
UbcE2M-RA 161..703 17..561 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:33:18 Download gff for BO06570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8197522..8197621 17..116 100   Minus
3L 8197142..8197443 117..418 100 <- Minus
3L 8196740..8196883 419..561 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:26:11 Download gff for BO06570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8190622..8190721 17..116 100   Minus
arm_3L 8190242..8190543 117..418 100 <- Minus
arm_3L 8189840..8189983 419..561 98 <- Minus

BO06570.pep Sequence

Translation from 16 to 577

> BO06570.pep
MIKLFTLKQQKKDGEQKGSQQKKASAAQLRIQKDINELNLPNTCATDFPD
PNDLLNFKLIISPDEGFYRDGRFVFNFRVGSNYPHEPPKVKCATQVYHPN
IDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDPLNKEAADVL
QTNRRQFENNVKKAMRGGCVGETYFECCLLKASFLDH

BO06570.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
UbcE2M-PC 181 CG7375-PC 1..181 1..181 975 100 Plus
UbcE2M-PB 181 CG7375-PB 1..181 1..181 975 100 Plus
UbcE2M-PA 181 CG7375-PA 1..181 1..181 975 100 Plus
Ubc6-PC 151 CG2013-PC 2..151 24..176 249 31 Plus
Ubc6-PA 151 CG2013-PA 2..151 24..176 249 31 Plus