Clone BO06606 Report

Search the DGRC for BO06606

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:66
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptDlc90F-RA
Protein status:BO06606.pep: validated full length
Sequenced Size:367

Clone Sequence Records

BO06606.3prime Sequence

365 bp (364 high quality bases) assembled on 2005-12-03

> BO06606.3prime
ATGGTCTAGAAAGCTTGCGACGGCCAGTCCGAAGACCGAAACGATGCAGT
ACATGGTCTTGTTCTCCCAGCGTACTGTGCACGATCCGTCGGTGTCGTTG
TTCCAGTAGCAGGAGCTGGCGGTGTGGAGTCCAGCACCGTTCTTTTGCAT
GATCATGGCGGTCACAATGTACTTGTAGGGCTTCTGCTCCTTGGTGAGCA
CCGTCAGGCAGTTCTCCACCACCTGGCCGGTCCAGTTGTTCACCTTGTCG
TGCTGGTAGGCGTTACCGCCGATGGTCGTCTCGATGGCCTCTTTAATCGT
CTTGCTCACGTCGTCCACAATGAACTGGCTTTCTTCGCGTGAGTCATCCA
TGTCGACTGATAACT

BO06606.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12363-PA 336 Dlc90F-RA 1..333 351..19 1665 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dlc90F-RA 816 CG12363-RA 194..526 351..19 1665 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18299422..18299754 351..19 1665 100 Minus
Blast to na_te.dros performed on 2015-02-11 22:54:59 has no hits.

BO06606.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:54:22 Download gff for BO06606.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12363-PA 1..336 18..351 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:28:46 Download gff for BO06606.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12363-PA 1..336 18..351 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:44:51 Download gff for BO06606.3prime
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 189..526 19..355 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:47:08 Download gff for BO06606.3prime
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 189..526 19..355 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:47:08 Download gff for BO06606.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 18299417..18299758 14..355 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:44:51 Download gff for BO06606.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14125139..14125480 14..355 98 -> Minus

BO06606.complete Sequence

367 bp (367 high quality bases) assembled on 2005-11-29

GenBank Submission: FJ630458

> BO06606.complete
GAAGTTATCAGTCGACATGGATGACTCACGCGAAGAAAGCCAGTTCATTG
TGGACGACGTGAGCAAGACGATTAAAGAGGCCATCGAGACGACCATCGGC
GGTAACGCCTACCAGCACGACAAGGTGAACAACTGGACCGGCCAGGTGGT
GGAGAACTGCCTGACGGTGCTCACCAAGGAGCAGAAGCCCTACAAGTACA
TTGTGACCGCCATGATCATGCAAAAGAACGGTGCTGGACTCCACACCGCC
AGCTCCTGCTACTGGAACAACGACACCGACGGATCGTGCACAGTACGCTG
GGAGAACAAGACCATGTACTGCATCGTTTCGGTCTTCGGACTGGCCGTCG
CAAGCTTTCTAGACCAT

BO06606.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dlc90F-RA 336 CG12363-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dlc90F-RA 816 CG12363-RA 194..526 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18299422..18299754 17..349 1665 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:09:20 has no hits.

BO06606.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:22:30 Download gff for BO06606.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 1..336 17..350 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:46:10 Download gff for BO06606.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 213..550 13..349 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:40:33 Download gff for BO06606.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 194..526 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:22:30 Download gff for BO06606.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 213..550 13..349 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:45:58 Download gff for BO06606.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 194..526 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:45:58 Download gff for BO06606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18299422..18299754 17..351 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:40:33 Download gff for BO06606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14125144..14125476 17..351 99   Plus

BO06606.pep Sequence

Translation from 16 to 367

> BO06606.pep
MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLT
VLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTM
YCIVSVFGLAVASFLDH

BO06606.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dlc90F-PA 111 CG12363-PA 1..111 1..111 596 100 Plus