Clone BO06694 Report

Search the DGRC for BO06694

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:66
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG30382-RA
Protein status:BO06694.pep: validated full length
Sequenced Size:766

Clone Sequence Records

BO06694.3prime Sequence

764 bp (763 high quality bases) assembled on 2005-12-03

> BO06694.3prime
ATGGTCTAGAAAGCTTGCGTCCTTCTCGGCGATCTTGGTGAGGTGTTCCT
CGATCTCCCGCTCATCCAAAATACGGAAAGTGGGATCAGACTTGCTGACC
ACGCCGATCTCAATGCCGTTCGGCTTGAAGTCTATAGCGAGCACACTGGA
CAGACAGGAGATGGCCAGCTGGATCGCTTTCTCCTCCGACAAGTTGGGCT
TGTACTTCTTTTCCAGATAGCTGTTGGCCTCCAGAGTCTTGGCACCCACG
CTGCAGGCCTTGAACCCGCTGAAGTAGCCAGCCGGGTCCGTCTTGTAAAC
GCTGGGGCCGATTTCATTGTCGTAAGCGATCAGCACCATGCTGCAGCCGA
GCGGACGCATCTCGGCATTCTGCGTGTACACCTGGTTGATATCCGCAATT
CGACGACACAGCACATCCACGGGCATTTCGTAGCCGTACTTGTAGCGGAA
GTTGGCGGCCTCGTATCTGGCCTTCTGCACCTGTGAGCGGGAATCAGCTA
TGCGTCCGGTCATTGCGCATCCAATGTCCTTGGTGATGCGGAACAGGTGG
GTCACCGTTTCAGGCACGATGTTCTTCTCGGTCACTTTTTTTTGGGTGGC
CACCACGGCACAGTCGCCACTCTTCAGCGCCACCGTGGTGATGTTCTCCT
GGGCAATAGCCTTGAAGGCGTACTCCACTTGGTAGAGGCGTCCCTCCGGA
GAGAAGATCGTGATGTGTCTGTCAAAGCCGGCTGAACTTCCGCGAGACAT
GTCGACTGATAACT

BO06694.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18495-PB 735 Prosalpha6-RB 1..732 750..19 3660 100 Minus
CG18495-PA 735 Prosalpha6-RA 1..732 750..19 3660 100 Minus
CG30382-PA 735 CG30382-RA 1..732 750..19 3660 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha1-RB 969 CG18495-RB 136..868 751..19 3665 100 Minus
Prosalpha1-RA 902 CG18495-RA 69..801 751..19 3665 100 Minus
CG30382-RB 885 CG30382-RB 52..784 751..19 3665 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 05:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7827404..7827885 19..500 2410 100 Plus
2R 25286936 2R 7830514..7830995 19..500 2410 100 Plus
2R 25286936 2R 7828171..7828348 498..675 890 100 Plus
2R 25286936 2R 7831281..7831458 498..675 890 100 Plus
2R 25286936 2R 7828410..7828486 675..751 385 100 Plus
2R 25286936 2R 7831520..7831596 675..751 385 100 Plus
Blast to na_te.dros performed on 2015-02-11 05:06:22 has no hits.

BO06694.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:56:59 Download gff for BO06694.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18495-PB 1..735 15..750 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:32:19 Download gff for BO06694.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30382-PA 1..735 15..750 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:19:40 Download gff for BO06694.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 47..792 8..757 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:53:02 Download gff for BO06694.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 47..792 8..757 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:53:02 Download gff for BO06694.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 7828410..7828491 675..757 96   Plus
2R 7828171..7828347 498..674 100 <- Plus
2R 7827396..7827882 8..497 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:19:40 Download gff for BO06694.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3715915..3715996 675..757 96   Plus
arm_2R 3715676..3715852 498..674 100 <- Plus
arm_2R 3714901..3715387 8..497 99 <- Plus

BO06694.5prime Sequence

764 bp (763 high quality bases) assembled on 2005-12-03

> BO06694.5prime
GAAGTTATCAGTCGACATGTCTCGCGGAAGTTCAGCCGGCTTTGACAGAC
ACATCACGATCTTCTCTCCGGAGGGACGCCTCTACCAAGTGGAGTACGCC
TTCAAGGCTATTGCCCAGGAGAACATCACCACGGTGGCGCTGAAGAGTGG
CGACTGTGCCGTGGTGGCCACCCAAAAAAAAGTGACCGAGAAGAACATCG
TGCCTGAAACGGTGACCCACCTGTTCCGCATCACCAAGGACATTGGATGC
GCAATGACCGGACGCATAGCTGATTCCCGCTCACAGGTGCAGAAGGCCAG
ATACGAGGCCGCCAACTTCCGCTACAAGTACGGCTACGAAATGCCCGTGG
ATGTGCTGTGTCGTCGAATTGCGGATATCAACCAGGTGTACACGCAGAAT
GCCGAGATGCGTCCGCTCGGCTGCAGCATGGTGCTGATCGCTTACGACAA
TGAAATCGGCCCCAGCGTTTACAAGACGGACCCGGCTGGCTACTTCAGCG
GGTTCAAGGCCTGCAGCGTGGGTGCCAAGACTCTGGAGGCCAACAGCTAT
CTGGAAAAGAAGTACAAGCCCAACTTGTCGGAGGAGAAAGCGATCCAGCT
GGCCATCTCCTGTCTGTCCAGTGTGCTCGCTATAGACTTCAAGCCGAACG
GCATTGAGATCGGCGTGGTCAGCAAGTCTGATCCCACTTTCCGTATTTTG
GATGAGCGGGAGATCGAGGAACACCTCACCAAGATCGCCGAGAAGGACGC
AAGCTTTCTAGACC

BO06694.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18495-PB 735 Prosalpha6-RB 1..732 17..748 3660 100 Plus
CG18495-PA 735 Prosalpha6-RA 1..732 17..748 3660 100 Plus
CG30382-PA 735 CG30382-RA 1..732 17..748 3660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha1-RB 969 CG18495-RB 136..868 16..748 3665 100 Plus
Prosalpha1-RA 902 CG18495-RA 69..801 16..748 3665 100 Plus
CG30382-RB 885 CG30382-RB 52..784 16..748 3665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7827404..7827885 748..267 2410 100 Minus
2R 25286936 2R 7830514..7830995 748..267 2410 100 Minus
2R 25286936 2R 7828171..7828348 269..92 890 100 Minus
2R 25286936 2R 7831281..7831458 269..92 890 100 Minus
2R 25286936 2R 7828410..7828486 92..16 385 100 Minus
2R 25286936 2R 7831520..7831596 92..16 385 100 Minus
Blast to na_te.dros performed on 2015-02-11 22:58:29 has no hits.

BO06694.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:57:00 Download gff for BO06694.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18495-PB 1..735 17..752 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:32:20 Download gff for BO06694.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30382-PA 1..735 17..752 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:45:08 Download gff for BO06694.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 47..792 10..759 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:47:41 Download gff for BO06694.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 47..792 10..759 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:47:41 Download gff for BO06694.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 7828410..7828491 10..92 96   Minus
2R 7828171..7828347 93..269 100 <- Minus
2R 7827396..7827882 270..759 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:45:08 Download gff for BO06694.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3715915..3715996 10..92 96   Minus
arm_2R 3715676..3715852 93..269 100 <- Minus
arm_2R 3714901..3715387 270..759 99 <- Minus

BO06694.complete Sequence

766 bp (766 high quality bases) assembled on 2005-11-29

GenBank Submission: FJ630497

> BO06694.complete
GAAGTTATCAGTCGACATGTCTCGCGGAAGTTCAGCCGGCTTTGACAGAC
ACATCACGATCTTCTCTCCGGAGGGACGCCTCTACCAAGTGGAGTACGCC
TTCAAGGCTATTGCCCAGGAGAACATCACCACGGTGGCGCTGAAGAGTGG
CGACTGTGCCGTGGTGGCCACCCAAAAAAAAGTGACCGAGAAGAACATCG
TGCCTGAAACGGTGACCCACCTGTTCCGCATCACCAAGGACATTGGATGC
GCAATGACCGGACGCATAGCTGATTCCCGCTCACAGGTGCAGAAGGCCAG
ATACGAGGCCGCCAACTTCCGCTACAAGTACGGCTACGAAATGCCCGTGG
ATGTGCTGTGTCGTCGAATTGCGGATATCAACCAGGTGTACACGCAGAAT
GCCGAGATGCGTCCGCTCGGCTGCAGCATGGTGCTGATCGCTTACGACAA
TGAAATCGGCCCCAGCGTTTACAAGACGGACCCGGCTGGCTACTTCAGCG
GGTTCAAGGCCTGCAGCGTGGGTGCCAAGACTCTGGAGGCCAACAGCTAT
CTGGAAAAGAAGTACAAGCCCAACTTGTCGGAGGAGAAAGCGATCCAGCT
GGCCATCTCCTGTCTGTCCAGTGTGCTCGCTATAGACTTCAAGCCGAACG
GCATTGAGATCGGCGTGGTCAGCAAGTCTGATCCCACTTTCCGTATTTTG
GATGAGCGGGAGATCGAGGAACACCTCACCAAGATCGCCGAGAAGGACGC
AAGCTTTCTAGACCAT

BO06694.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha1-RB 735 CG18495-PB 1..732 17..748 3660 100 Plus
Prosalpha1-RA 735 CG18495-PA 1..732 17..748 3660 100 Plus
CG30382-RB 735 CG30382-PB 1..732 17..748 3660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha1-RB 969 CG18495-RB 136..868 16..748 3665 100 Plus
Prosalpha1-RA 902 CG18495-RA 69..801 16..748 3665 100 Plus
CG30382-RB 885 CG30382-RB 52..784 16..748 3665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7827404..7827885 748..267 2410 100 Minus
2R 25286936 2R 7830514..7830995 748..267 2410 100 Minus
2R 25286936 2R 7828171..7828348 269..92 890 100 Minus
2R 25286936 2R 7831281..7831458 269..92 890 100 Minus
2R 25286936 2R 7828410..7828486 92..16 385 100 Minus
2R 25286936 2R 7831520..7831596 92..16 385 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:15:28 has no hits.

BO06694.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:01:07 Download gff for BO06694.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 1..735 17..752 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:33:18 Download gff for BO06694.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 112..857 10..759 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:51:22 Download gff for BO06694.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 53..784 17..750 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:01:07 Download gff for BO06694.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 112..857 10..759 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:32 Download gff for BO06694.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 53..784 17..750 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:14:32 Download gff for BO06694.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7828410..7828485 17..92 100   Minus
2R 7828171..7828347 93..269 100 <- Minus
2R 7827402..7827882 270..750 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:51:22 Download gff for BO06694.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3715915..3715990 17..92 100   Minus
arm_2R 3715676..3715852 93..269 100 <- Minus
arm_2R 3714907..3715387 270..750 99 <- Minus

BO06694.pep Sequence

Translation from 16 to 766

> BO06694.pep
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVV
ATQKKVTEKNIVPETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAAN
FRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPS
VYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCL
SSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKDASFLDH

BO06694.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha1-PB 244 CG18495-PB 1..244 1..244 1247 100 Plus
Prosalpha1-PA 244 CG18495-PA 1..244 1..244 1247 100 Plus
CG30382-PB 244 CG30382-PB 1..244 1..244 1247 100 Plus
CG30382-PA 244 CG30382-PA 1..244 1..244 1247 100 Plus
Prosalpha7-PA 253 CG1519-PA 7..240 8..242 317 30.5 Plus