Clone BO06709 Report

Search the DGRC for BO06709

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:67
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptHspB8-RA
Protein status:BO06709.pep: validated full length
Sequenced Size:583

Clone Sequence Records

BO06709.3prime Sequence

581 bp (580 high quality bases) assembled on 2005-12-03

> BO06709.3prime
ATGGTCTAGAAAGCTTGCCTTGTGCGCAATGGGAATCAGTGTCTCGCCGG
CGGTGAGTGCTGGCAGGGGGGCGTCCACGGTCAGGACTCCGTCCTTGCTG
AGGGACGAGCGGATGGACTCGGGATTGACGCCCTTGGGCAGCAGGAACTC
CCGATTGTACTCCCTGTACACGCTCTTTGTGTCCGACTTCTCCTCGTGCT
TGGCGTGCACCAATAGCTTCTGGTCGACGGTTTTCACAACAATTTCCTCG
GGCGCATACTGGCTGACATCGAAACGCAGCTTCAGCACTTTGTTATCGCC
CTCATCCTGGATCAAGGGTGAGCTAATGTCGGAGACGTAGTTCTGTTGCT
TTGGGATTCGGGATGGCAGCGCCGAGTTTGTCGTTGAGCTGGTGGACTCG
AAGAAGTTCGCCTCGCGGTTCATCAGCTCGTGACGGAACTTGGCCATCTC
CTCCTCCATTTTGCGCATCTCGGAGTCGAAGCGCTCGCGGATGTTGCTGA
ACTCCGTGTCGATGACGCTGAAGTCGCCCAGCTTGATGGGGATATTCCTC
TTGTTAGCCTCGGCCATGTCGACTGATAACT

BO06709.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PA 552 CG14207-RA 1..549 567..19 2745 100 Minus
CG14207-PB 579 CG14207-RB 202..576 393..19 1875 100 Minus
CG14207-PB 579 CG14207-RB 1..182 567..386 910 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-RD 1380 CG14207-RD 306..854 567..19 2745 100 Minus
CG14207-RA 1240 CG14207-RA 306..854 567..19 2745 100 Minus
CG14207-RC 753 CG14207-RC 110..487 396..19 1890 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19610695..19610887 211..19 965 100 Minus
X 23542271 X 19605504..19605682 567..389 895 100 Minus
X 23542271 X 19610525..19610625 309..209 505 100 Minus
X 23542271 X 19610378..19610463 391..306 430 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:16:03 has no hits.

BO06709.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:57:17 Download gff for BO06709.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-PA 1..552 16..567 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:32:44 Download gff for BO06709.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-PA 1..552 16..567 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:43:07 Download gff for BO06709.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 296..859 14..575 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:36:10 Download gff for BO06709.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 296..859 14..575 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:36:10 Download gff for BO06709.3prime
Subject Subject Range Query Range Percent Splice Strand
X 19610696..19610892 14..210 98   Minus
X 19610528..19610623 211..306 100 -> Minus
X 19610381..19610462 307..388 100 -> Minus
X 19605497..19605682 389..573 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:43:07 Download gff for BO06709.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19504729..19504925 14..210 98   Minus
arm_X 19504561..19504656 211..306 100 -> Minus
arm_X 19504414..19504495 307..388 100 -> Minus
arm_X 19499530..19499715 389..573 97 -> Minus

BO06709.5prime Sequence

581 bp (580 high quality bases) assembled on 2005-12-03

> BO06709.5prime
GAAGTTATCAGTCGACATGGCCGAGGCTAACAAGAGGAATATCCCCATCA
AGCTGGGCGACTTCAGCGTCATCGACACGGAGTTCAGCAACATCCGCGAG
CGCTTCGACTCCGAGATGCGCAAAATGGAGGAGGAGATGGCCAAGTTCCG
TCACGAGCTGATGAACCGCGAGGCGAACTTCTTCGAGTCCACCAGCTCAA
CGACAAACTCGGCGCTGCCATCCCGAATCCCAAAGCAACAGAACTACGTC
TCCGACATTAGCTCACCCTTGATCCAGGATGAGGGCGATAACAAAGTGCT
GAAGCTGCGTTTCGATGTCAGCCAGTATGCGCCCGAGGAAATTGTTGTGA
AAACCGTCGACCAGAAGCTATTGGTGCACGCCAAGCACGAGGAGAAGTCG
GACACAAAGAGCGTGTACAGGGAGTACAATCGGGAGTTCCTGCTGCCCAA
GGGCGTCAATCCCGAGTCCATCCGCTCGTCCCTCAGCAAGGACGGAGTCC
TGACCGTGGACGCCCCCCTGCCAGCACTCACCGCCGGCGAGACACTGATT
CCCATTGCGCACAAGGCAAGCTTTCTAGACC

BO06709.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PA 552 CG14207-RA 1..549 17..565 2745 100 Plus
CG14207-PB 579 CG14207-RB 202..576 191..565 1875 100 Plus
CG14207-PB 579 CG14207-RB 1..182 17..198 910 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-RD 1380 CG14207-RD 306..854 17..565 2745 100 Plus
CG14207-RA 1240 CG14207-RA 306..854 17..565 2745 100 Plus
CG14207-RC 753 CG14207-RC 110..487 188..565 1890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 05:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19610695..19610887 373..565 965 100 Plus
X 23542271 X 19605504..19605682 17..195 895 100 Plus
X 23542271 X 19610525..19610625 275..375 505 100 Plus
X 23542271 X 19610378..19610463 193..278 430 100 Plus
Blast to na_te.dros performed on 2015-02-11 05:06:37 has no hits.

BO06709.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:57:18 Download gff for BO06709.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-PA 1..552 17..568 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:32:46 Download gff for BO06709.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-PA 1..552 17..568 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:19:46 Download gff for BO06709.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 296..859 9..570 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:53:55 Download gff for BO06709.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 296..859 9..570 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:53:55 Download gff for BO06709.5prime
Subject Subject Range Query Range Percent Splice Strand
X 19610696..19610892 374..570 98   Plus
X 19610528..19610623 278..373 100 -> Plus
X 19610381..19610462 196..277 100 -> Plus
X 19605497..19605682 11..195 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:19:46 Download gff for BO06709.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19504729..19504925 374..570 98   Plus
arm_X 19504561..19504656 278..373 100 -> Plus
arm_X 19504414..19504495 196..277 100 -> Plus
arm_X 19499530..19499715 11..195 97 -> Plus

BO06709.complete Sequence

583 bp (583 high quality bases) assembled on 2005-11-29

GenBank Submission: FJ630500

> BO06709.complete
GAAGTTATCAGTCGACATGGCCGAGGCTAACAAGAGGAATATCCCCATCA
AGCTGGGCGACTTCAGCGTCATCGACACGGAGTTCAGCAACATCCGCGAG
CGCTTCGACTCCGAGATGCGCAAAATGGAGGAGGAGATGGCCAAGTTCCG
TCACGAGCTGATGAACCGCGAGGCGAACTTCTTCGAGTCCACCAGCTCAA
CGACAAACTCGGCGCTGCCATCCCGAATCCCAAAGCAACAGAACTACGTC
TCCGACATTAGCTCACCCTTGATCCAGGATGAGGGCGATAACAAAGTGCT
GAAGCTGCGTTTCGATGTCAGCCAGTATGCGCCCGAGGAAATTGTTGTGA
AAACCGTCGACCAGAAGCTATTGGTGCACGCCAAGCACGAGGAGAAGTCG
GACACAAAGAGCGTGTACAGGGAGTACAATCGGGAGTTCCTGCTGCCCAA
GGGCGTCAATCCCGAGTCCATCCGCTCGTCCCTCAGCAAGGACGGAGTCC
TGACCGTGGACGCCCCCCTGCCAGCACTCACCGCCGGCGAGACACTGATT
CCCATTGCGCACAAGGCAAGCTTTCTAGACCAT

BO06709.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-RD 552 CG14207-PD 1..549 17..565 2745 100 Plus
CG14207-RA 552 CG14207-PA 1..549 17..565 2745 100 Plus
CG14207-RC 465 CG14207-PC 85..462 188..565 1890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-RD 1380 CG14207-RD 306..854 17..565 2745 100 Plus
CG14207-RA 1240 CG14207-RA 306..854 17..565 2745 100 Plus
CG14207-RC 753 CG14207-RC 110..487 188..565 1890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19610695..19610887 373..565 965 100 Plus
X 23542271 X 19605504..19605682 17..195 895 100 Plus
X 23542271 X 19610525..19610625 275..375 505 100 Plus
X 23542271 X 19610378..19610463 193..278 430 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:38:46 has no hits.

BO06709.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:05:25 Download gff for BO06709.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 1..552 17..568 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:00 Download gff for BO06709.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 337..900 9..570 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:31 Download gff for BO06709.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 306..854 17..567 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:05:25 Download gff for BO06709.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 337..900 9..570 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:47 Download gff for BO06709.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 306..854 17..567 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:49:47 Download gff for BO06709.complete
Subject Subject Range Query Range Percent Splice Strand
X 19610696..19610887 374..567 98   Plus
X 19610528..19610623 278..373 100 -> Plus
X 19610381..19610462 196..277 100 -> Plus
X 19605504..19605682 17..195 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:31 Download gff for BO06709.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19504729..19504920 374..567 98   Plus
arm_X 19504561..19504656 278..373 100 -> Plus
arm_X 19504414..19504495 196..277 100 -> Plus
arm_X 19499537..19499715 17..195 100 -> Plus

BO06709.pep Sequence

Translation from 16 to 583

> BO06709.pep
MAEANKRNIPIKLGDFSVIDTEFSNIRERFDSEMRKMEEEMAKFRHELMN
REANFFESTSSTTNSALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFD
VSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPE
SIRSSLSKDGVLTVDAPLPALTAGETLIPIAHKASFLDH

BO06709.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PD 183 CG14207-PD 1..183 1..183 922 100 Plus
CG14207-PA 183 CG14207-PA 1..183 1..183 922 100 Plus
CG14207-PB 192 CG14207-PB 1..192 1..183 902 95.3 Plus
CG14207-PC 154 CG14207-PC 29..154 58..183 631 100 Plus
l(2)efl-PC 187 CG4533-PC 75..161 91..176 194 43.7 Plus