Clone BO06753 Report

Search the DGRC for BO06753

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:67
Well:53
Vector:pDNR-Dual
Associated Gene/Transcriptpex2-RA
Protein status:BO06753.pep: validated full length
Sequenced Size:877

Clone Sequence Records

BO06753.3prime Sequence

875 bp (786 high quality bases) assembled on 2005-12-03

> BO06753.3prime
ATGGTCTAGAAAGCTTGCGACACTTTGGATTCCCGACTCAGGACACGCAG
AACCGCAGTTGGGGCAGCAGAAACTGGCATCCGTTAAAACATTTGCATTA
AGGCAGTAATAGCAATAAATATGACCACAGCCCATGTGGTGGGGCAATGT
GGGTCGCTCTCCACAGAATGTGCAGGTGGTGCTTAGTGTCATCTGCGGCG
CCAGGAAAGCCGGACCATCTCTATCCTCTAACCGTCGTCCGGAAAATGTC
CATGATTTTAGCACTCTTTGTAGCTTACGGAAATTGATGATGGGCAACAC
CAGTCCGAGGATTTCCATAAATCCTCCCCACAGCAGCTCCCTCGTTAGGT
ACTTGTAGCCAATGTCTCTCCTTTGATTGTTCCGCAGACTAATGTAGTCC
AATCCCAATAAGTAGTCCACCAAAGTGGGTTTTCGTCCTGTCTTCAGGAA
CCGAAAGTAATTGAGGATGTTCAGTATCAGGGCACTGTTCTCCACCCACA
TAATCGCCTCGCTAAACCATTCTACGCGCCTTGTTAAGCGTCGCTCCTCC
CAGCTCTTCACGTAGCCCGGCAAGACGGTCAGGATGAAATGGAGCACCAG
CCTGGAAACGGTCAGCTTTTCGGCATCGTAAGCCAGAACCAGTAGCTGTT
GGCCAAAAGTGGAGCACCGCTTGCCGACGGAACCAAACCAAATTGCGGAT
TGAATGATCAAGTCGAGCTCCGGTTGGATTTTGATGAACAAAACGGGTGA
GATGGCTTGCAAGTTCTCCAGCAGATTATCGCGTATCAGGCGGGCAATGT
CCTTGTTCAAATAGATGGCATCTATCTGATTTACACGTGGTACATATTTG
TTTTTCTCCATGTCGACTGATAACT

BO06753.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG7081-PA 846 CG7081-RA 1..843 861..19 4215 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
Pex2-RA 1051 CG7081-RA 105..947 861..19 4215 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8339390..8339822 747..315 2165 100 Minus
3L 28110227 3L 8339875..8340172 316..19 1490 100 Minus
3L 28110227 3L 8339255..8339334 827..748 400 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:00:38 has no hits.

BO06753.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:58:30 Download gff for BO06753.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7081-PA 1..846 16..861 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:34:23 Download gff for BO06753.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7081-PA 1..846 16..861 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:45:20 Download gff for BO06753.3prime
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 105..947 19..861 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:47:57 Download gff for BO06753.3prime
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 105..947 19..861 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:47:57 Download gff for BO06753.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8339876..8340172 19..315 100   Minus
3L 8339390..8339821 316..747 100 -> Minus
3L 8339257..8339334 748..825 100 -> Minus
3L 8339155..8339190 826..861 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:45:20 Download gff for BO06753.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8332976..8333272 19..315 100   Minus
arm_3L 8332490..8332921 316..747 100 -> Minus
arm_3L 8332357..8332434 748..825 100 -> Minus
arm_3L 8332255..8332290 826..861 100 -> Minus

BO06753.5prime Sequence

874 bp (776 high quality bases) assembled on 2005-12-03

> BO06753.5prime
GAAGTTATCAGTCGACATGGAGAAAAACAAATATGTACCACGTGTAAATC
AGATAGATGCCATCTATTTGAACAAGGACATTGCCCGCCTGATACGCGAT
AATCTGCTGGAGAACTTGCAAGCCATCTCACCCGTTTTGTTCATCAAAAT
CCAACCGGAGCTCGACTTGATCATTCAATCCGCAATTTGGTTTGGTTCCG
TCGGCAAGCGGTGCTCCACTTTTGGCCAACAGCTACTGGTTCTGGCTTAC
GATGCCGAAAAGCTGACCGTTTCCAGGCTGGTGCTCCATTTCATCCTGAC
CGTCTTGCCGGGCTACGTGAAGAGCTGGGAGGAGCGACGCTTAACAAGGC
GCGTAGAATGGTTTAGCGAGGCGATTATGTGGGTGGAGAACAGTGCCCTG
ATACTGAACATCCTCAATTACTTTCGGTTCCTGAAGACAGGACGAAAACC
CACTTTGGTGGACTACTTATTGGGATTGGACTACATTAGTCTGCGGAACA
ATCAAAGGAGAGACATTGGCTACAAGTACCTAACGAGGGAGCTGCTGTGG
GGAGGATTTATGGAAATCCTCGGACTGGTGTTGCCCATCATCAATTTCCG
TAAGCTACAAAGAGTGCTAAAATCATGGACATTTTCCGGACGACGGTTAG
AGGATAGAGATGGTCCGGCTTTCCTGGCGCCGCAGATGACACTAAGCACC
ACCTGCACATTCTGTGGAGAGCGACCCACATTGCCCCACCACATGGGCTG
TGGTCATATTTATTGCTATTACTGCCTTAATGCAAATGTTTTAACGGATG
CCAGTTTCTGCTGCCCCAACTGCGGTTCTGCGTGTCCTGAGTCGGGATCC
AAAGTGTCGCAAGCTTTCTAGACC

BO06753.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7081-PA 846 CG7081-RA 1..831 17..847 4155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:21:45
Subject Length Description Subject Range Query Range Score Percent Strand
Pex2-RA 1051 CG7081-RA 105..947 17..858 4190 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8339390..8339822 131..563 2165 100 Plus
3L 28110227 3L 8339875..8340172 562..858 1440 99.7 Plus
3L 28110227 3L 8339255..8339334 51..130 400 100 Plus
Blast to na_te.dros performed on 2015-02-13 12:21:44 has no hits.

BO06753.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:58:31 Download gff for BO06753.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7081-PA 1..846 17..861 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:34:24 Download gff for BO06753.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7081-PA 1..846 17..861 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 18:00:52 Download gff for BO06753.5prime
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 105..947 17..858 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:34:15 Download gff for BO06753.5prime
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 105..947 17..858 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:34:15 Download gff for BO06753.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8339876..8340172 563..858 99   Plus
3L 8339390..8339821 131..562 100 -> Plus
3L 8339257..8339334 53..130 100 -> Plus
3L 8339155..8339190 17..52 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 18:00:52 Download gff for BO06753.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8332976..8333272 563..858 99   Plus
arm_3L 8332490..8332921 131..562 100 -> Plus
arm_3L 8332357..8332434 53..130 100 -> Plus
arm_3L 8332255..8332290 17..52 100 -> Plus

BO06753.complete Sequence

877 bp (877 high quality bases) assembled on 2005-11-29

GenBank Submission: FJ630518

> BO06753.complete
GAAGTTATCAGTCGACATGGAGAAAAACAAATATGTACCACGTGTAAATC
AGATAGATGCCATCTATTTGAACAAGGACATTGCCCGCCTGATACGCGAT
AATCTGCTGGAGAACTTGCAAGCCATCTCACCCGTTTTGTTCATCAAAAT
CCAACCGGAGCTCGACTTGATCATTCAATCCGCAATTTGGTTTGGTTCCG
TCGGCAAGCGGTGCTCCACTTTTGGCCAACAGCTACTGGTTCTGGCTTAC
GATGCCGAAAAGCTGACCGTTTCCAGGCTGGTGCTCCATTTCATCCTGAC
CGTCTTGCCGGGCTACGTGAAGAGCTGGGAGGAGCGACGCTTAACAAGGC
GCGTAGAATGGTTTAGCGAGGCGATTATGTGGGTGGAGAACAGTGCCCTG
ATACTGAACATCCTCAATTACTTTCGGTTCCTGAAGACAGGACGAAAACC
CACTTTGGTGGACTACTTATTGGGATTGGACTACATTAGTCTGCGGAACA
ATCAAAGGAGAGACATTGGCTACAAGTACCTAACGAGGGAGCTGCTGTGG
GGAGGATTTATGGAAATCCTCGGACTGGTGTTGCCCATCATCAATTTCCG
TAAGCTACAAAGAGTGCTAAAATCATGGACATTTTCCGGACGACGGTTAG
AGGATAGAGATGGTCCGGCTTTCCTGGCGCCGCAGATGACACTAAGCACC
ACCTGCACATTCTGTGGAGAGCGACCCACATTGCCCCACCACATGGGCTG
TGGTCATATTTATTGCTATTACTGCCTTAATGCAAATGTTTTAACGGATG
CCAGTTTCTGCTGCCCCAACTGCGGTTCTGCGTGTCCTGAGTCGGGAATC
CAAAGTGTCGCAAGCTTTCTAGACCAT

BO06753.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
Pex2-RA 846 CG7081-PA 1..843 17..859 4215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
Pex2-RA 1051 CG7081-RA 105..947 17..859 4215 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8339390..8339822 131..563 2165 100 Plus
3L 28110227 3L 8339875..8340172 562..859 1490 100 Plus
3L 28110227 3L 8339255..8339334 51..130 400 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:51:59 has no hits.

BO06753.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:21:23 Download gff for BO06753.complete
Subject Subject Range Query Range Percent Splice Strand
CG7081-RA 1..846 17..862 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:44:40 Download gff for BO06753.complete
Subject Subject Range Query Range Percent Splice Strand
CG7081-RA 103..945 17..859 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:13:53 Download gff for BO06753.complete
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 105..947 17..861 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:21:23 Download gff for BO06753.complete
Subject Subject Range Query Range Percent Splice Strand
CG7081-RA 103..945 17..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:27:48 Download gff for BO06753.complete
Subject Subject Range Query Range Percent Splice Strand
Pex2-RA 105..947 17..861 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:27:48 Download gff for BO06753.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8339876..8340172 563..861 99   Plus
3L 8339390..8339821 131..562 100 -> Plus
3L 8339257..8339334 53..130 100 -> Plus
3L 8339155..8339190 17..52 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:13:53 Download gff for BO06753.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8332976..8333272 563..861 99   Plus
arm_3L 8332490..8332921 131..562 100 -> Plus
arm_3L 8332357..8332434 53..130 100 -> Plus
arm_3L 8332255..8332290 17..52 100 -> Plus

BO06753.pep Sequence

Translation from 16 to 877

> BO06753.pep
MEKNKYVPRVNQIDAIYLNKDIARLIRDNLLENLQAISPVLFIKIQPELD
LIIQSAIWFGSVGKRCSTFGQQLLVLAYDAEKLTVSRLVLHFILTVLPGY
VKSWEERRLTRRVEWFSEAIMWVENSALILNILNYFRFLKTGRKPTLVDY
LLGLDYISLRNNQRRDIGYKYLTRELLWGGFMEILGLVLPIINFRKLQRV
LKSWTFSGRRLEDRDGPAFLAPQMTLSTTCTFCGERPTLPHHMGCGHIYC
YYCLNANVLTDASFCCPNCGSACPESGIQSVASFLDH

BO06753.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Pex2-PA 281 CG7081-PA 1..281 1..281 1490 100 Plus