Clone BO06807 Report

Search the DGRC for BO06807

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:68
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptRab2-RA
Protein status:BO06807.pep: validated full length
Sequenced Size:673

Clone Sequence Records

BO06807.3prime Sequence

671 bp (670 high quality bases) assembled on 2005-12-03

> BO06807.3prime
ATGGTCTAGAAAGCTTGCGCAGCAGCCACTGTTTGCTGCTCCAGCTGCTC
CTCCGGCTCCTGGGAGCGACGGGTTTGTGGGGGAGTGCTGTTGGCCGATC
TTAATGCCGTTTGCCTCATTGTTGATGTCGAAGACACCTTCCTGGATCTT
CTCGTAAATCTCTTTGGCCGTATTTATGAACGCCTCCTCTACGTTGGCAG
CTGTGCGCGCAGAAGTCTCCATGAAGACCAGTCCGTGCTCGCGGGCGAAG
GCCTCGCCCTCCTCTTTCTTCACCTCACGCCGCGAATCCAAATCGCTCTT
GTTGCCTATCAGCATAATGACCATGTTCGAGTTCGAGTGCTGACGCGCAT
CCTCCAGCCAGGTGGTCAGGTGGTTGAAGGTCTCCCGTCGCGTGATGTCG
TACACCAGCAAGGCGCCAGCAGCTCCGCGGTAATAAGAGCGTGTGATAGA
TCTGAAAGCCTCCTGCCCAGCCGTGTCCCAGATTTGAAGCTTGATCTGCT
TGCCGTCGATGGTGATCATGCGTGCTCCGAACTCCACGCCAATGGTCAGG
TCGTGCACCGGCTGGAATCGCTTGTCCGTGAACTGGAGCAGCAGACAGGA
CTTGCCCACGCCTGTGTCTCCGATAATGATGTATTTGAACAAGTACGCGT
AGGACATGTCGACTGATAACT

BO06807.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG3269-PA 642 Rab2-RA 1..639 657..19 3195 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 15:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-RB 1087 CG3269-RB 144..784 659..19 3205 100 Minus
Rab2-RA 1712 CG3269-RA 144..784 659..19 3205 100 Minus
Rab14-RD 878 CG4212-RD 105..343 636..398 310 76 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6698047..6698386 453..114 1700 100 Minus
2R 25286936 2R 6697413..6697575 614..452 815 100 Minus
2R 25286936 2R 6698444..6698541 116..19 490 100 Minus
2R 25286936 2R 6696882..6696940 659..601 250 94.9 Minus
2L 23513712 2L 14357540..14357688 546..398 250 77.9 Minus
2L 23513712 2L 14357385..14357450 636..571 180 84.8 Minus
Blast to na_te.dros performed on 2015-02-12 15:47:46 has no hits.

BO06807.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:00:05 Download gff for BO06807.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab2-PA 1..642 18..657 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:36:24 Download gff for BO06807.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3269-PA 1..642 18..657 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:14:47 Download gff for BO06807.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 144..784 19..659 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:23:44 Download gff for BO06807.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 144..784 19..659 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:23:44 Download gff for BO06807.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 6698446..6698541 19..114 100   Minus
2R 6698049..6698385 115..451 100 -> Minus
2R 6697416..6697575 452..611 100 -> Minus
2R 6696882..6696929 612..659 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:14:47 Download gff for BO06807.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2585951..2586046 19..114 100   Minus
arm_2R 2585554..2585890 115..451 100 -> Minus
arm_2R 2584921..2585080 452..611 100 -> Minus
arm_2R 2584387..2584434 612..659 100 -> Minus

BO06807.5prime Sequence

671 bp (670 high quality bases) assembled on 2005-12-03

> BO06807.5prime
GAAGTTATCAGTCGACATGTCCTACGCGTACTTGTTCAAATACATCATTA
TCGGAGACACAGGCGTGGGCAAGTCCTGTCTGCTGCTCCAGTTCACGGAC
AAGCGATTCCAGCCGGTGCACGACCTGACCATTGGCGTGGAGTTCGGAGC
ACGCATGATCACCATCGACGGCAAGCAGATCAAGCTTCAAATCTGGGACA
CGGCTGGGCAGGAGGCTTTCAGATCTATCACACGCTCTTATTACCGCGGA
GCTGCTGGCGCCTTGCTGGTGTACGACATCACGCGACGGGAGACCTTCAA
CCACCTGACCACCTGGCTGGAGGATGCGCGTCAGCACTCGAACTCGAACA
TGGTCATTATGCTGATAGGCAACAAGAGCGATTTGGATTCGCGGCGTGAG
GTGAAGAAAGAGGAGGGCGAGGCCTTCGCCCGCGAGCACGGACTGGTCTT
CATGGAGACTTCTGCGCGCACAGCTGCCAACGTAGAGGAGGCGTTCATAA
ATACGGCCAAAGAGATTTACGAGAAGATCCAGGAAGGTGTCTTCGACATC
AACAATGAGGCAAACGGCATTAAGATCGGCCAACAGCACTCCCCCACAAA
CCCGTCGCTCCCAGGAGCCGGAGGAGCAGCTGGAGCAGCAAACAGTGGCT
GCTGCGCAAGCTTTCTAGACC

BO06807.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG3269-PA 642 Rab2-RA 1..639 17..655 3195 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-RB 1087 CG3269-RB 144..784 15..655 3205 100 Plus
Rab2-RA 1712 CG3269-RA 144..784 15..655 3205 100 Plus
Rab14-RD 878 CG4212-RD 105..343 38..276 310 76 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6698047..6698386 221..560 1700 100 Plus
2R 25286936 2R 6697413..6697575 60..222 815 100 Plus
2R 25286936 2R 6698444..6698541 558..655 490 100 Plus
2R 25286936 2R 6696882..6696940 15..73 250 94.9 Plus
2L 23513712 2L 14357540..14357688 128..276 250 77.9 Plus
2L 23513712 2L 14357385..14357450 38..103 180 84.8 Plus
Blast to na_te.dros performed on 2015-02-13 16:09:49 has no hits.

BO06807.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:00:06 Download gff for BO06807.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab2-PA 1..642 17..656 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:36:25 Download gff for BO06807.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3269-PA 1..642 17..656 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:09:18 Download gff for BO06807.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 144..784 15..655 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:37:14 Download gff for BO06807.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 144..784 15..655 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:37:14 Download gff for BO06807.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 6698446..6698541 560..655 100   Plus
2R 6698049..6698385 223..559 100 -> Plus
2R 6697416..6697575 63..222 100 -> Plus
2R 6696882..6696929 15..62 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:09:18 Download gff for BO06807.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2585951..2586046 560..655 100   Plus
arm_2R 2585554..2585890 223..559 100 -> Plus
arm_2R 2584921..2585080 63..222 100 -> Plus
arm_2R 2584387..2584434 15..62 100 -> Plus

BO06807.complete Sequence

673 bp (673 high quality bases) assembled on 2005-11-29

GenBank Submission: FJ630540

> BO06807.complete
GAAGTTATCAGTCGACATGTCCTACGCGTACTTGTTCAAATACATCATTA
TCGGAGACACAGGCGTGGGCAAGTCCTGTCTGCTGCTCCAGTTCACGGAC
AAGCGATTCCAGCCGGTGCACGACCTGACCATTGGCGTGGAGTTCGGAGC
ACGCATGATCACCATCGACGGCAAGCAGATCAAGCTTCAAATCTGGGACA
CGGCTGGGCAGGAGGCTTTCAGATCTATCACACGCTCTTATTACCGCGGA
GCTGCTGGCGCCTTGCTGGTGTACGACATCACGCGACGGGAGACCTTCAA
CCACCTGACCACCTGGCTGGAGGATGCGCGTCAGCACTCGAACTCGAACA
TGGTCATTATGCTGATAGGCAACAAGAGCGATTTGGATTCGCGGCGTGAG
GTGAAGAAAGAGGAGGGCGAGGCCTTCGCCCGCGAGCACGGACTGGTCTT
CATGGAGACTTCTGCGCGCACAGCTGCCAACGTAGAGGAGGCGTTCATAA
ATACGGCCAAAGAGATTTACGAGAAGATCCAGGAAGGTGTCTTCGACATC
AACAATGAGGCAAACGGCATTAAGATCGGCCAACAGCACTCCCCCACAAA
CCCGTCGCTCCCAGGAGCCGGAGGAGCAGCTGGAGCAGCAAACAGTGGCT
GCTGCGCAAGCTTTCTAGACCAT

BO06807.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-RB 642 CG3269-PB 1..639 17..655 3195 100 Plus
Rab2-RA 642 CG3269-PA 1..639 17..655 3195 100 Plus
Rab14-RD 648 CG4212-PD 37..275 38..276 295 74.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-RB 1087 CG3269-RB 144..784 15..655 3205 100 Plus
Rab2-RA 1712 CG3269-RA 144..784 15..655 3205 100 Plus
Rab14-RD 878 CG4212-RD 105..343 38..276 295 74.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6698047..6698386 221..560 1700 100 Plus
2R 25286936 2R 6697413..6697575 60..222 815 100 Plus
2R 25286936 2R 6698444..6698541 558..655 490 100 Plus
2R 25286936 2R 6696882..6696940 15..73 250 94.9 Plus
2L 23513712 2L 14357540..14357688 128..276 250 77.9 Plus
2L 23513712 2L 14357385..14357450 38..103 180 84.8 Plus
Blast to na_te.dros performed on 2014-11-27 10:09:07 has no hits.

BO06807.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:53:32 Download gff for BO06807.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 1..642 17..656 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:25:42 Download gff for BO06807.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 161..801 15..655 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:36:18 Download gff for BO06807.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 146..784 17..657 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:53:33 Download gff for BO06807.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 161..801 15..655 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:19 Download gff for BO06807.complete
Subject Subject Range Query Range Percent Splice Strand
Rab2-RA 146..784 17..657 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:14:19 Download gff for BO06807.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6698446..6698541 560..657 97   Plus
2R 6698049..6698385 223..559 100 -> Plus
2R 6697416..6697575 63..222 100 -> Plus
2R 6696884..6696929 17..62 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:36:18 Download gff for BO06807.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2585951..2586046 560..657 97   Plus
arm_2R 2585554..2585890 223..559 100 -> Plus
arm_2R 2584921..2585080 63..222 100 -> Plus
arm_2R 2584389..2584434 17..62 100 -> Plus

BO06807.pep Sequence

Translation from 16 to 673

> BO06807.pep
MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITI
DGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTW
LEDARQHSNSNMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSA
RTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIGQQHSPTNPSLPG
AGGAAGAANSGCCASFLDH

BO06807.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Rab2-PB 213 CG3269-PB 1..213 1..213 1103 100 Plus
Rab2-PA 213 CG3269-PA 1..213 1..213 1103 100 Plus
Rab14-PD 215 CG4212-PD 7..213 2..212 648 60.2 Plus
Rab14-PA 215 CG4212-PA 7..213 2..212 648 60.2 Plus
Rab14-PB 239 CG4212-PB 31..237 2..212 648 60.2 Plus