Clone BO06957 Report

Search the DGRC for BO06957

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:69
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptRpS5a-RA
Protein status:BO06957.pep: validated full length
Sequenced Size:718

Clone Sequence Records

BO06957.3prime Sequence

716 bp (715 high quality bases) assembled on 2005-12-03

> BO06957.3prime
ATGGTCTAGAAAGCTTGCACGGTTGGACTTGGCGACACGCTCCAACTCAT
CCTTCTTCTTGATGGCGTACGAGTTGGAAGATCCCTTAGCAGCGTTGATC
AGCTCATCAGCCAGGCACTCGGCGATGGTCTTGATGTTCCTGAAGGCAGC
CTCACGAGCTCCAGTGCACAGCAGCCAGATAGCCTGGTTGACGCGACGCA
GGGGCGACACATCGACGGCCTGGCGACGGACGGTACCGGCACGTCCAATA
CGGGTGGAGTCCTCACGGGGTCCCGAGTTGATGATGGCGCTGACCAGGAT
CTGCAGAGGGTTCTCCCCGGTGAGCAGATGAATGATCTCGAACGAGTGCT
TGACGATGCGGCAGGCCATCAGCTTCTTGCCGTTGTTGCGACCCTTCATC
ATCAGGGAGCAGGTCAAACGCTCCACAATGGGGCACTGGGCCTTGCGGAA
ACGCTTGGCGGCATAACGTCCGGCGGAATGGGGAAGATAGCGGGCAAACT
TCTCCTTCACCGAGATGTAATCCTGCAGAGAGATGTCGTTAACGGTGACA
TCGTCGCAAGACCAGCGGCCGAACAGCTTGATCTCCGGCAGCTCAGTGGT
GGACACCACATTTGTCTCCAGGATCGTCTCGGCCACCTCGGCTTCCATAG
GTGCCGCTGGCTCCTCGAAGGTCTCCACCACGTTTTCAGCAACTTCGGCC
ATGTCGACTGATAACT

BO06957.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG8922-PA 687 RpS5a-RA 1..684 702..19 3420 100 Minus
CG7014-PA 693 RpS5b-RA 586..683 123..26 290 91.8 Minus
CG7014-PA 693 RpS5b-RA 202..290 507..419 170 87.6 Minus
CG7014-PA 693 RpS5b-RA 343..386 366..323 145 93.1 Minus
CG7014-PA 693 RpS5b-RA 484..527 225..182 145 93.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
RpS5a-RA 864 CG8922-RA 61..746 704..19 3430 100 Minus
RpS5a-RD 809 CG8922-RD 7..691 703..19 3425 100 Minus
RpS5a-RC 1380 CG8922-RC 578..1262 703..19 3425 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17146798..17147200 301..703 2015 100 Plus
3R 32079331 3R 14900952..14901358 183..589 970 82.6 Plus
X 23542271 X 17145015..17145137 183..305 615 100 Plus
3R 32079331 3R 14900530..14900697 19..186 525 87.5 Plus
X 23542271 X 17144617..17144718 84..185 510 100 Plus
X 23542271 X 17143706..17143773 19..86 340 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:14:24 has no hits.

BO06957.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:04:52 Download gff for BO06957.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS5a-PA 1..687 15..702 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:42:36 Download gff for BO06957.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8922-PA 1..687 15..702 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:09:54 Download gff for BO06957.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 61..750 14..704 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:21:05 Download gff for BO06957.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 61..750 14..704 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:21:05 Download gff for BO06957.3prime
Subject Subject Range Query Range Percent Splice Strand
X 17146798..17147200 301..703 100   Plus
X 17145016..17145132 184..300 100 <- Plus
X 17144618..17144716 85..183 100 <- Plus
X 17143702..17143771 14..84 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:09:54 Download gff for BO06957.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17040831..17041233 301..703 100   Plus
arm_X 17039049..17039165 184..300 100 <- Plus
arm_X 17038651..17038749 85..183 100 <- Plus
arm_X 17037735..17037804 14..84 97 <- Plus

BO06957.5prime Sequence

716 bp (715 high quality bases) assembled on 2005-12-03

> BO06957.5prime
GAAGTTATCAGTCGACATGGCCGAAGTTGCTGAAAACGTGGTGGAGACCT
TCGAGGAGCCAGCGGCACCTATGGAAGCCGAGGTGGCCGAGACGATCCTG
GAGACAAATGTGGTGTCCACCACTGAGCTGCCGGAGATCAAGCTGTTCGG
CCGCTGGTCTTGCGACGATGTCACCGTTAACGACATCTCTCTGCAGGATT
ACATCTCGGTGAAGGAGAAGTTTGCCCGCTATCTTCCCCATTCCGCCGGA
CGTTATGCCGCCAAGCGTTTCCGCAAGGCCCAGTGCCCCATTGTGGAGCG
TTTGACCTGCTCCCTGATGATGAAGGGTCGCAACAACGGCAAGAAGCTGA
TGGCCTGCCGCATCGTCAAGCACTCGTTCGAGATCATTCATCTGCTCACC
GGGGAGAACCCTCTGCAGATCCTGGTCAGCGCCATCATCAACTCGGGACC
CCGTGAGGACTCCACCCGTATTGGACGTGCCGGTACCGTCCGTCGCCAGG
CCGTCGATGTGTCGCCCCTGCGTCGCGTCAACCAGGCTATCTGGCTGCTG
TGCACTGGAGCTCGTGAGGCTGCCTTCAGGAACATCAAGACCATCGCCGA
GTGCCTGGCTGATGAGCTGATCAACGCTGCTAAGGGATCTTCCAACTCGT
ACGCCATCAAGAAGAAGGATGAGTTGGAGCGTGTCGCCAAGTCCAACCGT
GCAAGCTTTCTAGACC

BO06957.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8922-PA 687 RpS5a-RA 1..684 17..700 3420 100 Plus
CG7014-PA 693 RpS5b-RA 586..683 596..693 290 91.8 Plus
CG7014-PA 693 RpS5b-RA 202..290 212..300 170 87.6 Plus
CG7014-PA 693 RpS5b-RA 343..386 353..396 145 93.1 Plus
CG7014-PA 693 RpS5b-RA 484..527 494..537 145 93.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpS5a-RA 864 CG8922-RA 61..746 15..700 3430 100 Plus
RpS5a-RD 809 CG8922-RD 7..691 16..700 3425 100 Plus
RpS5a-RC 1380 CG8922-RC 578..1262 16..700 3425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17146798..17147200 418..16 2015 100 Minus
3R 32079331 3R 14900952..14901358 536..130 970 82.6 Minus
X 23542271 X 17145015..17145137 536..414 615 100 Minus
3R 32079331 3R 14900530..14900697 700..533 525 87.5 Minus
X 23542271 X 17144617..17144718 635..534 510 100 Minus
X 23542271 X 17143706..17143773 700..633 340 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:12:07 has no hits.

BO06957.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:04:54 Download gff for BO06957.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS5a-PA 1..687 17..704 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:42:38 Download gff for BO06957.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8922-PA 1..687 17..704 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:03:28 Download gff for BO06957.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 61..750 15..705 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:24:47 Download gff for BO06957.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 61..750 15..705 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:24:47 Download gff for BO06957.5prime
Subject Subject Range Query Range Percent Splice Strand
X 17146798..17147200 16..418 100   Minus
X 17145016..17145132 419..535 100 <- Minus
X 17144618..17144716 536..634 100 <- Minus
X 17143702..17143771 635..705 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:03:28 Download gff for BO06957.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 17040831..17041233 16..418 100   Minus
arm_X 17039049..17039165 419..535 100 <- Minus
arm_X 17038651..17038749 536..634 100 <- Minus
arm_X 17037735..17037804 635..705 97 <- Minus

BO06957.complete Sequence

718 bp (718 high quality bases) assembled on 2005-12-09

GenBank Submission: FJ630609

> BO06957.complete
GAAGTTATCAGTCGACATGGCCGAAGTTGCTGAAAACGTGGTGGAGACCT
TCGAGGAGCCAGCGGCACCTATGGAAGCCGAGGTGGCCGAGACGATCCTG
GAGACAAATGTGGTGTCCACCACTGAGCTGCCGGAGATCAAGCTGTTCGG
CCGCTGGTCTTGCGACGATGTCACCGTTAACGACATCTCTCTGCAGGATT
ACATCTCGGTGAAGGAGAAGTTTGCCCGCTATCTTCCCCATTCCGCCGGA
CGTTATGCCGCCAAGCGTTTCCGCAAGGCCCAGTGCCCCATTGTGGAGCG
TTTGACCTGCTCCCTGATGATGAAGGGTCGCAACAACGGCAAGAAGCTGA
TGGCCTGCCGCATCGTCAAGCACTCGTTCGAGATCATTCATCTGCTCACC
GGGGAGAACCCTCTGCAGATCCTGGTCAGCGCCATCATCAACTCGGGACC
CCGTGAGGACTCCACCCGTATTGGACGTGCCGGTACCGTCCGTCGCCAGG
CCGTCGATGTGTCGCCCCTGCGTCGCGTCAACCAGGCTATCTGGCTGCTG
TGCACTGGAGCTCGTGAGGCTGCCTTCAGGAACATCAAGACCATCGCCGA
GTGCCTGGCTGATGAGCTGATCAACGCTGCTAAGGGATCTTCCAACTCGT
ACGCCATCAAGAAGAAGGATGAGTTGGAGCGTGTCGCCAAGTCCAACCGT
GCAAGCTTTCTAGACCAT

BO06957.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
RpS5a-RD 687 CG8922-PD 1..684 17..700 3420 100 Plus
RpS5a-RC 687 CG8922-PC 1..684 17..700 3420 100 Plus
RpS5a-RB 687 CG8922-PB 1..684 17..700 3420 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
RpS5a-RA 864 CG8922-RA 61..746 15..700 3430 100 Plus
RpS5a-RD 809 CG8922-RD 7..691 16..700 3425 100 Plus
RpS5a-RC 1380 CG8922-RC 578..1262 16..700 3425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17146798..17147200 418..16 2015 100 Minus
3R 32079331 3R 14900952..14901358 536..130 970 82.6 Minus
X 23542271 X 17145015..17145137 536..414 615 100 Minus
3R 32079331 3R 14900530..14900697 700..533 525 87.5 Minus
X 23542271 X 17144617..17144718 635..534 510 100 Minus
X 23542271 X 17143706..17143773 700..633 340 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:27:46 has no hits.

BO06957.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:19:54 Download gff for BO06957.complete
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 1..687 17..704 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:42:46 Download gff for BO06957.complete
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 51..740 15..705 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:10:24 Download gff for BO06957.complete
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 63..746 17..702 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:19:54 Download gff for BO06957.complete
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 51..740 15..705 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:21:53 Download gff for BO06957.complete
Subject Subject Range Query Range Percent Splice Strand
RpS5a-RA 63..746 17..702 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:21:53 Download gff for BO06957.complete
Subject Subject Range Query Range Percent Splice Strand
X 17146798..17147199 17..418 100   Minus
X 17145016..17145132 419..535 100 <- Minus
X 17144618..17144716 536..634 100 <- Minus
X 17143704..17143771 635..702 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:10:24 Download gff for BO06957.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17040831..17041232 17..418 100   Minus
arm_X 17039049..17039165 419..535 100 <- Minus
arm_X 17038651..17038749 536..634 100 <- Minus
arm_X 17037737..17037804 635..702 97 <- Minus

BO06957.pep Sequence

Translation from 16 to 718

> BO06957.pep
MAEVAENVVETFEEPAAPMEAEVAETILETNVVSTTELPEIKLFGRWSCD
DVTVNDISLQDYISVKEKFARYLPHSAGRYAAKRFRKAQCPIVERLTCSL
MMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSAIINSGPREDST
RIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADE
LINAAKGSSNSYAIKKKDELERVAKSNRASFLDH

BO06957.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:32:29
Subject Length Description Subject Range Query Range Score Percent Strand
RpS5a-PD 228 CG8922-PD 1..228 1..228 1153 100 Plus
RpS5a-PC 228 CG8922-PC 1..228 1..228 1153 100 Plus
RpS5a-PB 228 CG8922-PB 1..228 1..228 1153 100 Plus
RpS5a-PA 228 CG8922-PA 1..228 1..228 1153 100 Plus
RpS5b-PA 230 CG7014-PA 1..230 4..228 929 79.1 Plus