Clone BO07013 Report

Search the DGRC for BO07013

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:70
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG6971-RA
Protein status:BO07013.pep: validated full length
Sequenced Size:784

Clone Sequence Records

BO07013.5prime Sequence

782 bp (761 high quality bases) assembled on 2005-12-03

> BO07013.5prime
GAAGTTATCAGTCGACATGGAGGAGCTGGATATAACAAGCGTGGGTCAAT
TCCAGACCCTGGTGCGCTACAACAACCCGGTGCTGGTGGTGAAGCACCCG
GACAAGAAAGGGGGTGCTCCGCTCACAGAGATAGAGATGAAAAGGCCCCA
AACGGCGGGCGCTTTGCTAGATACCAAAAGGGAAACTGAGGAAATTCTAA
ATTCTATATTGCCACCGCGCTGCTGGGAGGAGGATGGCCAGTTGTGGCAG
CAGTCTGTGTCCAGTACTCCAGCAACACGCCAGGATGTGATCAATTTGCA
GGAGATGCTTGATACTAGGCTGCAGCAGACCCAAGCTCGTGAGACAGGTA
TTTGTCCCGTGCGCCGCGAGCTGTACTCACAATGTTTTGACGAGATCATT
CGCCAGGTCACCATTAACTGTTCAGAGCGTGGCCTGCTACTGCTTCGCAT
CCGCGATGAGATCGCCATGTCAATGGAGGCCTATGAAACATTGTACTGCA
GTTCCGTAGCCTTTGGCATGCGCAAGGCTTTGCAGGCGCATGAGGAAAAG
GAAATGCTTCGTGATCGGGTCAAGACTCTTGAACTAGACAAAGAGGCACT
AGAGGAGATAATCGCAGATATGAAACTTAAGCAGGAACAGGCAGAGCGTC
GTAATGCTGAGCTGAGGGCCTCTGAAGAAAAGAAGTTCACGGAGGAGATA
ACTTTCCTGAAGAAGACCAACGCTCAGCTGAAGGCTCAGCTAGAGGGCAT
AACCGCACCCAAGAAGGCAAGCTTTCTAGACC

BO07013.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-PA 753 CG6971-RA 1..750 17..766 3750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-RA 939 CG6971-RA 97..846 17..766 3750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11892399..11892776 766..389 1890 100 Minus
3R 32079331 3R 11892829..11893201 389..17 1865 100 Minus
Blast to na_te.dros performed on 2015-02-13 01:31:00 has no hits.

BO07013.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:06:35 Download gff for BO07013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-PA 1..753 17..770 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:44:47 Download gff for BO07013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-PA 1..753 17..770 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:31:03 Download gff for BO07013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 90..849 9..770 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:17:23 Download gff for BO07013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 90..849 9..770 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:17:23 Download gff for BO07013.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11892829..11893208 9..389 98   Minus
3R 11892395..11892775 390..770 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:31:03 Download gff for BO07013.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7718551..7718930 9..389 98   Minus
arm_3R 7718117..7718497 390..770 99 <- Minus

BO07013.3prime Sequence

782 bp (781 high quality bases) assembled on 2005-12-03

> BO07013.3prime
ATGGTCTAGAAAGCTTGCCTTCTTGGGTGCGGTTATGCCCTCTAGCTGAG
CCTTCAGCTGAGCGTTGGTCTTCTTCAGGAAAGTTATCTCCTCCGTGAAC
TTCTTTTCTTCAGAGGCCCTCAGCTCAGCATTACGACGCTCTGCCTGTTC
CTGCTTAAGTTTCATATCTGCGATTATCTCCTCTAGTGCCTCTTTGTCTA
GTTCAAGAGTCTTGACCCGATCACGAAGCATTTCCTTTTCCTCATGCGCC
TGCAAAGCCTTGCGCATGCCAAAGGCTACGGAACTGCAGTACAATGTTTC
ATAGGCCTCCATTGACATGGCGATCTCATCGCGGATGCGAAGCAGTAGCA
GGCCACGCTCTGAACAGTTAATGGTGACCTGGCGAATGATCTCGTCAAAA
CATTGTGAGTACAGCTCGCGGCGCACGGGACAAATACCTGTCTCACGAGC
TTGGGTCTGCTGCAGCCTAGTATCAAGCATCTCCTGCAAATTGATCACAT
CCTGGCGTGTTGCTGGAGTACTGGACACAGACTGCTGCCACAACTGGCCA
TCCTCCTCCCAGCAGCGCGGTGGCAATATAGAATTTAGAATTTCCTCAGT
TTCCCTTTTGGTATCTAGCAAAGCGCCCGCCGTTTGGGGCCTTTTCATCT
CTATCTCTGTGAGCGGAGCACCCCCTTTCTTGTCCGGGTGCTTCACCACC
AGCACCGGGTTGTTGTAGCGCACCAGGGTCTGGAATTGACCCACGCTTGT
TATATCCAGCTCCTCCATGTCGACTGATAACT

BO07013.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-PA 753 CG6971-RA 1..750 768..19 3750 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-RA 939 CG6971-RA 97..846 768..19 3750 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11892399..11892776 19..396 1890 100 Plus
3R 32079331 3R 11892829..11893201 396..768 1865 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:15:23 has no hits.

BO07013.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:06:34 Download gff for BO07013.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-PA 1..753 15..768 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:44:46 Download gff for BO07013.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-PA 1..753 15..768 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:10:04 Download gff for BO07013.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 90..849 15..776 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:24:45 Download gff for BO07013.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 90..849 15..776 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:24:45 Download gff for BO07013.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11892829..11893208 396..776 98   Plus
3R 11892395..11892775 15..395 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:10:04 Download gff for BO07013.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7718551..7718930 396..776 98   Plus
arm_3R 7718117..7718497 15..395 99 <- Plus

BO07013.complete Sequence

784 bp (784 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630626

> BO07013.complete
GAAGTTATCAGTCGACATGGAGGAGCTGGATATAACAAGCGTGGGTCAAT
TCCAGACCCTGGTGCGCTACAACAACCCGGTGCTGGTGGTGAAGCACCCG
GACAAGAAAGGGGGTGCTCCGCTCACAGAGATAGAGATGAAAAGGCCCCA
AACGGCGGGCGCTTTGCTAGATACCAAAAGGGAAACTGAGGAAATTCTAA
ATTCTATATTGCCACCGCGCTGCTGGGAGGAGGATGGCCAGTTGTGGCAG
CAGTCTGTGTCCAGTACTCCAGCAACACGCCAGGATGTGATCAATTTGCA
GGAGATGCTTGATACTAGGCTGCAGCAGACCCAAGCTCGTGAGACAGGTA
TTTGTCCCGTGCGCCGCGAGCTGTACTCACAATGTTTTGACGAGATCATT
CGCCAGGTCACCATTAACTGTTCAGAGCGTGGCCTGCTACTGCTTCGCAT
CCGCGATGAGATCGCCATGTCAATGGAGGCCTATGAAACATTGTACTGCA
GTTCCGTAGCCTTTGGCATGCGCAAGGCTTTGCAGGCGCATGAGGAAAAG
GAAATGCTTCGTGATCGGGTCAAGACTCTTGAACTAGACAAAGAGGCACT
AGAGGAGATAATCGCAGATATGAAACTTAAGCAGGAACAGGCAGAGCGTC
GTAATGCTGAGCTGAGGGCCTCTGAAGAAAAGAAGTTCACGGAGGAGATA
ACTTTCCTGAAGAAGACCAACGCTCAGCTGAAGGCTCAGCTAGAGGGCAT
AACCGCACCCAAGAAGGCAAGCTTTCTAGACCAT

BO07013.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-RA 753 CG6971-PA 1..750 17..766 3750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-RA 939 CG6971-RA 97..846 17..766 3750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11892399..11892776 766..389 1890 100 Minus
3R 32079331 3R 11892829..11893201 389..17 1865 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:24:53 has no hits.

BO07013.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:18:56 Download gff for BO07013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 1..753 17..770 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:41:36 Download gff for BO07013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 90..849 9..770 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:46 Download gff for BO07013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 97..846 17..768 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:18:56 Download gff for BO07013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 90..849 9..770 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:20:56 Download gff for BO07013.complete
Subject Subject Range Query Range Percent Splice Strand
CG6971-RA 97..846 17..768 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:20:56 Download gff for BO07013.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11892829..11893201 17..389 100   Minus
3R 11892397..11892775 390..768 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:46 Download gff for BO07013.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7718551..7718923 17..389 100   Minus
arm_3R 7718119..7718497 390..768 99 <- Minus

BO07013.pep Sequence

Translation from 16 to 784

> BO07013.pep
MEELDITSVGQFQTLVRYNNPVLVVKHPDKKGGAPLTEIEMKRPQTAGAL
LDTKRETEEILNSILPPRCWEEDGQLWQQSVSSTPATRQDVINLQEMLDT
RLQQTQARETGICPVRRELYSQCFDEIIRQVTINCSERGLLLLRIRDEIA
MSMEAYETLYCSSVAFGMRKALQAHEEKEMLRDRVKTLELDKEALEEIIA
DMKLKQEQAERRNAELRASEEKKFTEEITFLKKTNAQLKAQLEGITAPKK
ASFLDH

BO07013.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:42:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6971-PA 250 CG6971-PA 1..250 1..250 1263 100 Plus