Clone BO07024 Report

Search the DGRC for BO07024

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:70
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptProsalpha7-RA
Protein status:BO07024.pep: validated full length
Sequenced Size:793

Clone Sequence Records

BO07024.5prime Sequence

791 bp (790 high quality bases) assembled on 2005-12-03

> BO07024.5prime
GAAGTTATCAGTCGACATGAGTACTATTGGCACTGGATACGACTTGTCGG
CCTCGCAGTTTTCGCCTGATGGCCGCGTTTTCCAGATCGACTACGCCTCA
AAGGCGGTGGAGAAGAGCGGCACCGTAATCGGGATTCGGGGCAAGGACGC
CGTGGTGCTGGCCGTGGAGAAGATCATCACCAGTAAACTGTACGAACCAG
ACGCCGGCGGACGCATCTTCACCATCGAAAAGAACATCGGAATGGCGGTG
GCCGGCTTGGTGGCCGATGGAAACTTTGTGGCTGACATTGCGCGTCAGGA
GGCAGCCAACTACAGACAGCAATTTGAGCAGGCTATCCCGCTTAAACACC
TGTGCCACCGAGTCGCCGGCTACGTTCACGCCTACACTCTGTACAGTGCC
GTCCGCCCCTTCGGACTTTCCATCATTCTCGCCTCCTGGGACGAAGTAGA
GGGGCCACAGCTCTACAAGATCGAGCCGTCCGGCTCCTCCTTCGGTTACT
TCGCCTGCGCCAGCGGCAAGGCCAAGCAGCTGGCCAAGACTGAGATGGAG
AAGCTCAAGATGGATATGAGGACCGACGAATTGGTGGAGAGCGCTGGTGA
AATCATCTACAAAGTCCATGACGAGTTGAAGGACAAGGACTTCCGCTTCG
AAATGGGTTTGGTGGGCAGGGTAACCGGTGGCCTACATCTCATAAATCCC
TCAGAACTGACGGAGAAGGCGAGGAAAGCCGGCGATGCGGCCAACAAGGA
CGAAGACAGCGACAATGAGACGCACGCAAGCTTTCTAGACC

BO07024.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG1519-PA 762 Prosalpha7-RA 1..759 17..775 3795 100 Plus
CG1519-PB 708 Prosalpha7-RB 1..421 17..437 2105 100 Plus
CG1519-PB 708 Prosalpha7-RB 416..705 486..775 1450 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 976 CG1519-RA 120..878 17..775 3795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9847073..9847638 603..38 2830 100 Minus
2R 25286936 2R 9846734..9846905 775..604 860 100 Minus
Blast to na_te.dros performed 2015-02-13 00:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 1817..1864 526..575 136 80 Plus

BO07024.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:06:59 Download gff for BO07024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1519-PA 1..762 17..776 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:45:18 Download gff for BO07024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1519-PA 1..762 17..776 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:22:28 Download gff for BO07024.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 112..883 8..783 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:39:48 Download gff for BO07024.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 112..883 8..783 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:39:48 Download gff for BO07024.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 9847073..9847638 38..603 100 <- Minus
2R 9846729..9846905 604..783 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:22:28 Download gff for BO07024.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5734578..5735143 38..603 100 <- Minus
arm_2R 5734234..5734410 604..783 97 <- Minus

BO07024.3prime Sequence

791 bp (790 high quality bases) assembled on 2005-12-03

> BO07024.3prime
ATGGTCTAGAAAGCTTGCGTGCGTCTCATTGTCGCTGTCTTCGTCCTTGT
TGGCCGCATCGCCGGCTTTCCTCGCCTTCTCCGTCAGTTCTGAGGGATTT
ATGAGATGTAGGCCACCGGTTACCCTGCCCACCAAACCCATTTCGAAGCG
GAAGTCCTTGTCCTTCAACTCGTCATGGACTTTGTAGATGATTTCACCAG
CGCTCTCCACCAATTCGTCGGTCCTCATATCCATCTTGAGCTTCTCCATC
TCAGTCTTGGCCAGCTGCTTGGCCTTGCCGCTGGCGCAGGCGAAGTAACC
GAAGGAGGAGCCGGACGGCTCGATCTTGTAGAGCTGTGGCCCCTCTACTT
CGTCCCAGGAGGCGAGAATGATGGAAAGTCCGAAGGGGCGGACGGCACTG
TACAGAGTGTAGGCGTGAACGTAGCCGGCGACTCGGTGGCACAGGTGTTT
AAGCGGGATAGCCTGCTCAAATTGCTGTCTGTAGTTGGCTGCCTCCTGAC
GCGCAATGTCAGCCACAAAGTTTCCATCGGCCACCAAGCCGGCCACCGCC
ATTCCGATGTTCTTTTCGATGGTGAAGATGCGTCCGCCGGCGTCTGGTTC
GTACAGTTTACTGGTGATGATCTTCTCCACGGCCAGCACCACGGCGTCCT
TGCCCCGAATCCCGATTACGGTGCCGCTCTTCTCCACCGCCTTTGAGGCG
TAGTCGATCTGGAAAACGCGGCCATCAGGCGAAAACTGCGAGGCCGACAA
GTCGTATCCAGTGCCAATAGTACTCATGTCGACTGATAACT

BO07024.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG1519-PA 762 Prosalpha7-RA 1..759 777..19 3795 100 Minus
CG1519-PB 708 Prosalpha7-RB 1..421 777..357 2105 100 Minus
CG1519-PB 708 Prosalpha7-RB 416..705 308..19 1450 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 976 CG1519-RA 120..878 777..19 3795 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9847073..9847638 191..756 2830 100 Plus
2R 25286936 2R 9846734..9846905 19..190 860 100 Plus
Blast to na_te.dros performed 2015-02-11 16:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 1817..1864 268..219 136 80 Minus

BO07024.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:06:57 Download gff for BO07024.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1519-PA 1..762 18..777 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:45:16 Download gff for BO07024.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1519-PA 1..762 18..777 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:41:43 Download gff for BO07024.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 112..883 11..786 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:00:31 Download gff for BO07024.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 112..883 11..786 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:00:31 Download gff for BO07024.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 9847073..9847638 191..756 100 <- Plus
2R 9846729..9846905 11..190 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:41:43 Download gff for BO07024.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5734578..5735143 191..756 100 <- Plus
arm_2R 5734234..5734410 11..190 97 <- Plus

BO07024.complete Sequence

793 bp (793 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630631

> BO07024.complete
GAAGTTATCAGTCGACATGAGTACTATTGGCACTGGATACGACTTGTCGG
CCTCGCAGTTTTCGCCTGATGGCCGCGTTTTCCAGATCGACTACGCCTCA
AAGGCGGTGGAGAAGAGCGGCACCGTAATCGGGATTCGGGGCAAGGACGC
CGTGGTGCTGGCCGTGGAGAAGATCATCACCAGTAAACTGTACGAACCAG
ACGCCGGCGGACGCATCTTCACCATCGAAAAGAACATCGGAATGGCGGTG
GCCGGCTTGGTGGCCGATGGAAACTTTGTGGCTGACATTGCGCGTCAGGA
GGCAGCCAACTACAGACAGCAATTTGAGCAGGCTATCCCGCTTAAACACC
TGTGCCACCGAGTCGCCGGCTACGTTCACGCCTACACTCTGTACAGTGCC
GTCCGCCCCTTCGGACTTTCCATCATTCTCGCCTCCTGGGACGAAGTAGA
GGGGCCACAGCTCTACAAGATCGAGCCGTCCGGCTCCTCCTTCGGTTACT
TCGCCTGCGCCAGCGGCAAGGCCAAGCAGCTGGCCAAGACTGAGATGGAG
AAGCTCAAGATGGATATGAGGACCGACGAATTGGTGGAGAGCGCTGGTGA
AATCATCTACAAAGTCCATGACGAGTTGAAGGACAAGGACTTCCGCTTCG
AAATGGGTTTGGTGGGCAGGGTAACCGGTGGCCTACATCTCATAAATCCC
TCAGAACTGACGGAGAAGGCGAGGAAAGCCGGCGATGCGGCCAACAAGGA
CGAAGACAGCGACAATGAGACGCACGCAAGCTTTCTAGACCAT

BO07024.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 762 CG1519-PA 1..759 17..775 3795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-RA 976 CG1519-RA 120..878 17..775 3795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9847073..9847638 603..38 2830 100 Minus
2R 25286936 2R 9846734..9846905 775..604 860 100 Minus
Blast to na_te.dros performed 2014-11-27 20:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 1817..1864 526..575 136 80 Plus

BO07024.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:11:41 Download gff for BO07024.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 1..762 17..776 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:04:30 Download gff for BO07024.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 110..881 8..783 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:05:10 Download gff for BO07024.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 120..878 17..777 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:11:41 Download gff for BO07024.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 110..881 8..783 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:17:36 Download gff for BO07024.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha7-RA 120..878 17..777 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:17:36 Download gff for BO07024.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9847697..9847717 17..37 100   Minus
2R 9847073..9847638 38..603 100 <- Minus
2R 9846732..9846905 604..777 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:05:10 Download gff for BO07024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5735202..5735222 17..37 100   Minus
arm_2R 5734578..5735143 38..603 100 <- Minus
arm_2R 5734237..5734410 604..777 98 <- Minus

BO07024.pep Sequence

Translation from 16 to 793

> BO07024.pep
MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAV
EKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR
QQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLY
KIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKV
HDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDEDSDN
ETHASFLDH

BO07024.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha7-PA 253 CG1519-PA 1..253 1..253 1291 100 Plus
Prosalpha1-PB 244 CG18495-PB 8..242 7..240 317 30.5 Plus
Prosalpha1-PA 244 CG18495-PA 8..242 7..240 317 30.5 Plus
CG30382-PB 244 CG30382-PB 8..242 7..240 317 30.5 Plus
CG30382-PA 244 CG30382-PA 8..242 7..240 317 30.5 Plus