Clone BO07059 Report

Search the DGRC for BO07059

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:70
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptSnap-RA
Protein status:BO07059.pep: validated full length
Sequenced Size:910

Clone Sequence Records

BO07059.3prime Sequence

907 bp (848 high quality bases) assembled on 2005-12-03

> BO07059.3prime
ATGGTCTAGAAAGCTTGCTCGCAGATCGGGATCCTCGTCCGCAGCCTTCT
TGATCCGCAGCAAGATGGTGGTGTACCACTGATCCAACCGGGAGATGCTG
TCGTAGTCCTTGACGGCCTCTGTGAATCCCTCGATGTTCTGTTCCTCTAG
ATTCTCGCACAACACCTTGATGAGCTTGAACTCCCTGGAGTCCTGGAATG
CTGGGTACTGCTGCGCATACTTTTCGATGGCATGCTGGGCGTTCAGGAGG
TCCACGCTGAGATGGCATAGAGCGGCCCTGAAGAAGTACTCCTTGGCACT
GTACTTGAGCAGAGAGCTCTCCAGCGAGGAGGCGGCCACCTGCTCGTATA
TGGATATTGCTTTCTCGTAATCCTCCAGTTGGGCGGCGTACTGGGCCACC
TTCAACATGCACTTGTTGGCCGAACTGACCGACTCTTCACCCTTGAAGTA
ATCAGCCGCCTGCTCATAGTGCTGAATAGACTTGGCCAGATTATTGGGAT
CACTTTCGTACATCTCGGCGATGCTTTGGTGATGTTTGGCAGCCATCGTA
AAGCGGCCCATATCCGTGTAGATGTCGATGGACTTCATCAGGCAGTTGAC
GGCGCTCTCCACGTCCACCTTCTTGTAGCAGTTGGAAGCGTCTACGTAGC
AGGTTCCGGCATCGTGACGACTTCCAGCCCGCGCGTGTAGAGTTGCCGCC
TCGCAGAAGCACTCCCCAGCCTTTGTCCAGTTTTTGGACATCTTAAACAT
GTTGCCCGCCCGCTGGTAGCACTCGATGGCGTCCTCCACCTTGTTGGACC
CTCCGAACAGCGATCCCAGAAAGCCCTTCTGCTGGGTCAACTTCTTCTCC
GCCTCGGGCATCAGCTGGAGCGCCTTCTGTTCGTTGTCCCCATGTCGACT
GGATACT

BO07059.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6625-PA 879 Snap-RA 7..876 888..19 4325 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
alphaSnap-RA 2070 CG6625-RA 157..1037 898..19 4365 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20314982..20315306 487..163 1625 100 Minus
3L 28110227 3L 20314607..20314924 803..486 1590 100 Minus
3L 28110227 3L 20315396..20315544 167..19 745 100 Minus
3L 28110227 3L 20313788..20313884 898..803 420 97.9 Minus
Blast to na_te.dros performed on 2015-02-11 23:15:12 has no hits.

BO07059.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:08:00 Download gff for BO07059.3prime
Subject Subject Range Query Range Percent Splice Strand
Snap-PA 1..879 15..893 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:46:34 Download gff for BO07059.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6625-PA 1..879 15..893 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:46:27 Download gff for BO07059.3prime
Subject Subject Range Query Range Percent Splice Strand
Snap-RA 151..1040 15..907 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:49:58 Download gff for BO07059.3prime
Subject Subject Range Query Range Percent Splice Strand
alphaSnap-RA 151..1040 15..907 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:49:58 Download gff for BO07059.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 20315398..20315547 15..165 98   Minus
3L 20314983..20315303 166..486 100 -> Minus
3L 20314608..20314923 487..802 100 -> Minus
3L 20313782..20313884 803..907 94 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:46:27 Download gff for BO07059.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20308498..20308647 15..165 98   Minus
arm_3L 20308083..20308403 166..486 100 -> Minus
arm_3L 20307708..20308023 487..802 100 -> Minus
arm_3L 20306882..20306984 803..907 94 -> Minus

BO07059.5prime Sequence

907 bp (797 high quality bases) assembled on 2005-12-03

> BO07059.5prime
GAAGTTATCAGTCGACATGGGTGACAACGAACAGAAGGCGCTCCAGCTGA
TGGCCGAGGCGGAGAAGAAGTTGACCCAGCAGAAGGGCTTTCTGGGATCG
CTGTTCGGAGGGTCCAACAAGGTGGAGGACGCCATCGAGTGCTACCAGCG
GGCGGGCAACATGTTTAAGATGTCCAAAAACTGGACAAAGGCTGGGGAGT
GCTTCTGCGAGGCGGCAACTCTACACGCGCGGGCTGGAAGTCGTCACGAT
GCCGGAACCTGCTACGTAGACGCTTCCAACTGCTACAAGAAGGTGGACGT
GGAGAGCGCCGTCAACTGCCTGATGAAGTCCATCGACATCTACACGGATA
TGGGCCGCTTTACGATGGCTGCCAAACATCACCAAAGCATCGCCGAGATG
TACGAAAGTGATCCCAATAATCTGGCCAAGTCTATTCAGCACTATGAGCA
GGCGGCTGATTACTTCAAGGGTGAAGAGTCGGTCAGTTCGGCCAACAAGT
GCATGTTGAAGGTGGCCCAGTACGCCGCCCAACTGGAGGATTACGAGAAA
GCAATATCCATATACGAGCAGGTGGCCGCCTCCTCGCTGGAGAGCTCTCT
GCTCAAGTACAGTGCCAAGGAGTACTTCTTCAGGGCCGCTCTATGCCATC
TCAGCGTGGACCTCCTGAACGCCCAGCATGCCATCGAAAAGTATGCGCAG
CAGTACCCAGCATTCCAGGACTCCAGGGAGTTCAAGCTCATCAAGGTGTT
GTGCGAGAATCTAGAGGAACAGAACATCGAGGGATTCACAGAGGCCGTCA
AGGACTACGACAGCATCTCCCGGTTGGATCAGTGGTACACCACCATCTTG
CTGCGGATCAGAANGCTGCGGACGAGGATCCCGATCTGCGAGCAAGCTTT
CTAGACC

BO07059.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6625-PA 879 Snap-RA 1..844 17..860 4220 100 Plus
CG6625-PA 879 Snap-RA 845..876 860..891 141 96.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
alphaSnap-RA 2070 CG6625-RA 157..1037 12..891 4369 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 05:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20314982..20315306 424..748 1625 100 Plus
3L 28110227 3L 20314607..20314924 108..425 1590 100 Plus
3L 28110227 3L 20315396..20315544 744..891 684 98.7 Plus
3L 28110227 3L 20313788..20313884 12..108 485 100 Plus
Blast to na_te.dros performed on 2015-02-11 05:09:13 has no hits.

BO07059.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:08:01 Download gff for BO07059.5prime
Subject Subject Range Query Range Percent Splice Strand
Snap-PA 1..879 17..895 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:46:36 Download gff for BO07059.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6625-PA 1..879 17..895 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:20:58 Download gff for BO07059.5prime
Subject Subject Range Query Range Percent Splice Strand
Snap-RA 153..1040 7..895 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:33:40 Download gff for BO07059.5prime
Subject Subject Range Query Range Percent Splice Strand
alphaSnap-RA 153..1040 7..895 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:33:40 Download gff for BO07059.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 20315398..20315547 746..895 97   Plus
3L 20314983..20315303 425..745 100 -> Plus
3L 20314608..20314923 109..424 100 -> Plus
3L 20313784..20313884 7..108 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:20:58 Download gff for BO07059.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20308498..20308647 746..895 97   Plus
arm_3L 20308083..20308403 425..745 100 -> Plus
arm_3L 20307708..20308023 109..424 100 -> Plus
arm_3L 20306884..20306984 7..108 98 -> Plus

BO07059.complete Sequence

910 bp (910 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630641

> BO07059.complete
GAAGTTATCAGTCGACATGGGTGACAACGAACAGAAGGCGCTCCAGCTGA
TGGCCGAGGCGGAGAAGAAGTTGACCCAGCAGAAGGGCTTTCTGGGATCG
CTGTTCGGAGGGTCCAACAAGGTGGAGGACGCCATCGAGTGCTACCAGCG
GGCGGGCAACATGTTTAAGATGTCCAAAAACTGGACAAAGGCTGGGGAGT
GCTTCTGCGAGGCGGCAACTCTACACGCGCGGGCTGGAAGTCGTCACGAT
GCCGGAACCTGCTACGTAGACGCTTCCAACTGCTACAAGAAGGTGGACGT
GGAGAGCGCCGTCAACTGCCTGATGAAGTCCATCGACATCTACACGGATA
TGGGCCGCTTTACGATGGCTGCCAAACATCACCAAAGCATCGCCGAGATG
TACGAAAGTGATCCCAATAATCTGGCCAAGTCTATTCAGCACTATGAGCA
GGCGGCTGATTACTTCAAGGGTGAAGAGTCGGTCAGTTCGGCCAACAAGT
GCATGTTGAAGGTGGCCCAGTACGCCGCCCAACTGGAGGATTACGAGAAA
GCAATATCCATATACGAGCAGGTGGCCGCCTCCTCGCTGGAGAGCTCTCT
GCTCAAGTACAGTGCCAAGGAGTACTTCTTCAGGGCCGCTCTATGCCATC
TCAGCGTGGACCTCCTGAACGCCCAGCATGCCATCGAAAAGTATGCGCAG
CAGTACCCAGCATTCCAGGACTCCAGGGAGTTCAAGCTCATCAAGGTGTT
GTGCGAGAATCTAGAGGAACAGAACATCGAGGGATTCACAGAGGCCGTCA
AGGACTACGACAGCATCTCCCGGTTGGATCAGTGGTACACCACCATCTTG
CTGCGGATCAAGAAGGCTGCGGACGAGGATCCCGATCTGCGAGCAAGCTT
TCTAGACCAT

BO07059.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
alphaSnap-RA 879 CG6625-PA 1..876 17..892 4380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
alphaSnap-RA 2070 CG6625-RA 157..1037 12..892 4405 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20314982..20315306 424..748 1625 100 Plus
3L 28110227 3L 20314607..20314924 108..425 1590 100 Plus
3L 28110227 3L 20315396..20315544 744..892 745 100 Plus
3L 28110227 3L 20313788..20313884 12..108 485 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:43:14 has no hits.

BO07059.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:18:44 Download gff for BO07059.complete
Subject Subject Range Query Range Percent Splice Strand
Snap-RA 1..879 17..896 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:41:18 Download gff for BO07059.complete
Subject Subject Range Query Range Percent Splice Strand
Snap-RA 151..1038 7..896 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:21 Download gff for BO07059.complete
Subject Subject Range Query Range Percent Splice Strand
Snap-RA 162..1037 17..894 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:18:44 Download gff for BO07059.complete
Subject Subject Range Query Range Percent Splice Strand
Snap-RA 151..1038 7..896 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:14:47 Download gff for BO07059.complete
Subject Subject Range Query Range Percent Splice Strand
alphaSnap-RA 162..1037 17..894 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:14:47 Download gff for BO07059.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20315398..20315544 746..894 98   Plus
3L 20314983..20315303 425..745 100 -> Plus
3L 20314608..20314923 109..424 100 -> Plus
3L 20313793..20313884 17..108 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:21 Download gff for BO07059.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20308498..20308644 746..894 98   Plus
arm_3L 20308083..20308403 425..745 100 -> Plus
arm_3L 20307708..20308023 109..424 100 -> Plus
arm_3L 20306893..20306984 17..108 100 -> Plus

BO07059.pep Sequence

Translation from 16 to 910

> BO07059.pep
MGDNEQKALQLMAEAEKKLTQQKGFLGSLFGGSNKVEDAIECYQRAGNMF
KMSKNWTKAGECFCEAATLHARAGSRHDAGTCYVDASNCYKKVDVESAVN
CLMKSIDIYTDMGRFTMAAKHHQSIAEMYESDPNNLAKSIQHYEQAADYF
KGEESVSSANKCMLKVAQYAAQLEDYEKAISIYEQVAASSLESSLLKYSA
KEYFFRAALCHLSVDLLNAQHAIEKYAQQYPAFQDSREFKLIKVLCENLE
EQNIEGFTEAVKDYDSISRLDQWYTTILLRIKKAADEDPDLRASFLDH

BO07059.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
alphaSnap-PA 292 CG6625-PA 1..292 1..292 1513 100 Plus