Clone BO07072 Report

Search the DGRC for BO07072

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:70
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptPk17E-RA
Protein status:BO07072.pep: validated full length
Sequenced Size:1483

Clone Sequence Records

BO07072.3prime Sequence

855 bp (854 high quality bases) assembled on 2005-12-03

> BO07072.3prime
ATGGTCTAGAAAGCTTGCGAAGTCCAGGAAAGCATCGATGGCACACTGAT
TGGTCAGCTGGTCGAAATGCCTGTCCTCGTAGATACGGATTCCATCCCTG
GCTATAATCTCCCGAGGCGAGAGACTTAGCAGCTGCTTGGAGCTCAGGTT
ATAGTCCTTGTAGATGGCAATCCTTTGGAGCGCCATCACACTGCGGATAC
GCTGGCGCGGCTCAATGGTGAGCAGCTTGCGCAGCACATCCCTGCCCTCG
TGGGTGAGGTGCTGCACCTCCTCCGGCAGGAAGTCCTCGCTGTCGCCGTC
ACTGTCCTGCAGGCAGCCGTTGATCTGAGCAATGGATGGGGCATTGGACA
GGCCGTCCTCCGGCTCCACGCTCTCACGCCGTCGCAGTAGGTGGCGTTTG
ATGTTGGGCGACTTCTGCGTCAGCATCTGACAGGCAATAACGCCCAAGGC
CCACCAGTCCACCGCATGGCCATAGGGTTCCCCGCACAGAATCTCCGGGG
CCATGTATTTGAAAGTGCCACACATGGTGCGCGTGTTTGCCCCCAGTTTG
AGCCACTTGCTAAGGCCGAAGTCGGTTAGCTTTATGTGAAACTGTTCAGT
TAGCAGGATGTTCTCCGGCTTCGCATCACGATATATAATCCCAGCGTTGT
GGAGAAAATCCAAGGCAAGTGCTATCTCGCCAATGTATAAACGAACCAGA
TCAATGGAGAAGTGAGTTATTTTTGAGAACAACTCGCCGTTGGGTACGTA
CTCCGATAGAATATGGAGGTTGTGGCGGTTTTGCCACAGATCTATTTGCT
TCACGATAAACGGATGATGGCCGCAAACCTTCTGAATGTCCGCCTCGTCC
TTTAT

BO07072.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7001-PA 1452 Pk17E-RA 613..1449 855..19 4185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-RC 2123 CG7001-RC 975..1811 855..19 4185 100 Minus
Pk17E-RB 1651 CG7001-RB 503..1339 855..19 4185 100 Minus
Pk17E-RA 2129 CG7001-RA 981..1817 855..19 4185 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18805292..18805581 413..124 1450 100 Minus
X 23542271 X 18791300..18791459 660..501 800 100 Minus
X 23542271 X 18805641..18805745 123..19 525 100 Minus
X 23542271 X 18791146..18791244 758..660 495 100 Minus
X 23542271 X 18790985..18791081 855..759 485 100 Minus
X 23542271 X 18793758..18793847 501..412 450 100 Minus
Blast to na_te.dros performed on 2015-02-13 12:36:11 has no hits.

BO07072.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:08:26 Download gff for BO07072.3prime
Subject Subject Range Query Range Percent Splice Strand
Pk17E-PA 613..1452 18..855 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:47:12 Download gff for BO07072.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7001-PA 613..1452 18..855 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 18:02:52 Download gff for BO07072.3prime
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 981..1821 13..855 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:15:34 Download gff for BO07072.3prime
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 981..1821 13..855 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:15:34 Download gff for BO07072.3prime
Subject Subject Range Query Range Percent Splice Strand
X 18805641..18805749 13..123 97   Minus
X 18805294..18805581 124..411 100 -> Minus
X 18793759..18793847 412..500 100 -> Minus
X 18791301..18791459 501..659 100 -> Minus
X 18791146..18791244 660..758 100 -> Minus
X 18790985..18791081 759..855 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 18:02:52 Download gff for BO07072.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 18699674..18699782 13..123 97   Minus
arm_X 18699327..18699614 124..411 100 -> Minus
arm_X 18687792..18687880 412..500 100 -> Minus
arm_X 18685334..18685492 501..659 100 -> Minus
arm_X 18685179..18685277 660..758 100 -> Minus
arm_X 18685018..18685114 759..855 100 -> Minus

BO07072.5prime Sequence

916 bp (800 high quality bases) assembled on 2005-12-03

> BO07072.5prime
GAAGTTATCAGTCGACATGGGCAACTCGCAACCGCGTAATGCAAGCAGAA
GCAGAAGGACATCCCAGTGGCCACAAGGCGCAGCGGAACTAGGCGCCTCA
GCCAGCGATCACCACTACCACCAGGAGGAGCTGTATCAGGAGCAGCAGCA
GCAGCAACAACAGCCGCAACAGGAGCAACCGAGCAGCAGGAGAATCCAGT
TCCAGGCCCACACCAACCAGCCAACACAGTCGCATCCTCCGGGCGACGAG
GAACAGCCTGTACAATCACAGCAGCAACAGCTTTCCACCTGGAGTCTTGG
CAGCCTTAGCGGAGGACGACTCAACTGGAGCTTCTCCGGTGCCCGCAACT
CATTTCGTCATCGAAACAAGGCCACGCGAAAGAGCTTGACCTCACTTCAT
GGCTCTCGTCGTGGCAAGACTCAGTGGCACCGACCTCTGACCAACTCAAT
CTTCAACTCGCACTTTAAGGAGACCAGCAAGAACGATCTGTACCGTATCG
ATCATTTGGTGGCCAAGGGAGCCTTTGGCGTGGTCTTCAAGGTGTCCAGC
AAGAGTGACATTAGTCAGTGCTACGCCCTGAAAGTGCTAAAGAAATCAAA
GCTCATCGAAGACAACAGTGTACGGCAGATAAAGGACGAGGCGGACATTC
AGAAGGTTTGCGGCCATCATCCGTTTATCGTGAAGCAAATAGATCTGTGG
CAAAACCGCCACAACCTCCATATTCTATCGGAGTACGTACCCAACGGCGA
GTTGTTCTCAAAAATAACTCACTTCTCCATTGATCTGGTTCGTTTATACA
TTGGCGAGATAGCACTTGCCTTGGATTTTCTCCCACACGCTGGGATTATA
TATCGTGATGCGAAGCCGGAGAACATCCTGCTAACTGAACAGTTTCACAT
AAAGCTAACCGACTTT

BO07072.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG7001-PA 1452 Pk17E-RA 1..817 17..833 4085 100 Plus
CG7001-PA 1452 Pk17E-RA 821..899 837..915 395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-RA 2129 CG7001-RA 369..1267 17..915 4450 99.8 Plus
Pk17E-RC 2123 CG7001-RC 369..1261 17..915 4350 99.1 Plus
Pk17E-RB 1651 CG7001-RB 145..789 271..915 3180 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18788832..18789089 17..274 1290 100 Plus
X 23542271 X 18790675..18790893 383..601 1095 100 Plus
X 23542271 X 18790956..18791081 600..725 630 100 Plus
X 23542271 X 18790503..18790615 272..384 565 100 Plus
X 23542271 X 18791146..18791244 726..824 495 100 Plus
X 23542271 X 18791300..18791391 824..915 415 96.7 Plus
Blast to na_te.dros performed 2015-02-11 23:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6887 147..304 202 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6996 70..279 198 60.6 Plus

BO07072.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:08:27 Download gff for BO07072.5prime
Subject Subject Range Query Range Percent Splice Strand
Pk17E-PA 1..899 17..916 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:47:13 Download gff for BO07072.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7001-PA 1..899 17..916 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:46:30 Download gff for BO07072.5prime
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 369..1267 17..916 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:50:02 Download gff for BO07072.5prime
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 369..1267 17..916 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:50:02 Download gff for BO07072.5prime
Subject Subject Range Query Range Percent Splice Strand
X 18791301..18791391 825..916 96   Plus
X 18791146..18791244 726..824 100 -> Plus
X 18790958..18791081 602..725 100 -> Plus
X 18790677..18790893 385..601 100 -> Plus
X 18790506..18790615 275..384 100 -> Plus
X 18788832..18789089 17..274 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:46:30 Download gff for BO07072.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 18685334..18685424 825..916 96   Plus
arm_X 18685179..18685277 726..824 100 -> Plus
arm_X 18684991..18685114 602..725 100 -> Plus
arm_X 18684710..18684926 385..601 100 -> Plus
arm_X 18684539..18684648 275..384 100 -> Plus
arm_X 18682865..18683122 17..274 100 -> Plus

BO07072.complete Sequence

1483 bp (1483 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630649

> BO07072.complete
GAAGTTATCAGTCGACATGGGCAACTCGCAACCGCGTAATGCAAGCAGAA
GCAGAAGGACATCCCAGTGGCCACAAGGCGCAGCGGAACTAGGCGCCTCA
GCCAGCGATCACCACTACCACCAGGAGGAGCTGTATCAGGAGCAGCAGCA
GCAGCAACAACAGCCGCAACAGGAGCAACCGAGCAGCAGGAGAATCCAGT
TCCAGGCCCACACCAACCAGCCAACACAGTCGCATCCTCCGGGCGACGAG
GAACAGCCTGTACAATCACAGCAGCAACAGCTTTCCACCTGGAGTCTTGG
CAGCCTTAGCGGAGGACGACTCAACTGGAGCTTCTCCGGTGCCCGCAACT
CATTTCGTCATCGAAACAAGGCCACGCGAAAGAGCTTGACCTCACTTCAT
GGCTCTCGTCGTGGCAAGACTCAGTGGCACCGACCTCTGACCAACTCAAT
CTTCAACTCGCACTTTAAGGAGACCAGCAAGAACGATCTGTACCGTATCG
ATCATTTGGTGGCCAAGGGAGCCTTTGGCGTGGTCTTCAAGGTGTCCAGC
AAGAGTGACATTAGTCAGTGCTACGCCCTGAAAGTGCTAAAGAAATCAAA
GCTCATCGAAGACAACAGTGTACGGCAGATAAAGGACGAGGCGGACATTC
AGAAGGTTTGCGGCCATCATCCGTTTATCGTGAAGCAAATAGATCTGTGG
CAAAACCGCCACAACCTCCATATTCTATCGGAGTACGTACCCAACGGCGA
GTTGTTCTCAAAAATAACTCACTTCTCCATTGATCTGGTTCGTTTATACA
TTGGCGAGATAGCACTTGCCTTGGATTTTCTCCACAACGCTGGGATTATA
TATCGTGATGCGAAGCCGGAGAACATCCTGCTAACTGAACAGTTTCACAT
AAAGCTAACCGACTTCGGCCTTAGCAAGTGGCTCAAACTGGGGGCAAACA
CGCGCACCATGTGTGGCACTTTCAAATACATGGCCCCGGAGATTCTGTGC
GGGGAACCCTATGGCCATGCGGTGGACTGGTGGGCCTTGGGCGTTATTGC
CTGTCAGATGCTGACGCAGAAGTCGCCCAACATCAAACGCCACCTACTGC
GACGGCGTGAGAGCGTGGAGCCGGAGGACGGCCTGTCCAATGCCCCATCC
ATTGCTCAGATCAACGGCTGCCTGCAGGACAGTGACGGCGACAGCGAGGA
CTTCCTGCCGGAGGAGGTGCAGCACCTCACCCACGAGGGCAGGGATGTGC
TGCGCAAGCTGCTCACCATTGAGCCGCGCCAGCGTATCCGCAGTGTGATG
GCGCTCCAAAGGATTGCCATCTACAAGGACTATAACCTGAGCTCCAAGCA
GCTGCTAAGTCTCTCGCCTCGGGAGATTATAGCCAGGGATGGAATCCGTA
TCTACGAGGACAGGCATTTCGACCAGCTGACCAATCAGTGTGCCATCGAT
GCTTTCCTGGACTTCGCAAGCTTTCTAGACCAT

BO07072.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-RA 1452 CG7001-PA 1..1449 17..1465 7245 100 Plus
Pk17E-RC 1446 CG7001-PC 1..1443 17..1465 7120 99.6 Plus
Pk17E-RB 510 CG7001-PB 1..507 959..1465 2535 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-RA 2129 CG7001-RA 369..1817 17..1465 7245 100 Plus
Pk17E-RC 2123 CG7001-RC 369..1811 17..1465 7120 99.6 Plus
Pk17E-RB 1651 CG7001-RB 145..1339 271..1465 5975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18805292..18805581 1071..1360 1450 100 Plus
X 23542271 X 18788832..18789089 17..274 1290 100 Plus
X 23542271 X 18790675..18790893 383..601 1095 100 Plus
X 23542271 X 18791300..18791459 824..983 800 100 Plus
X 23542271 X 18790956..18791081 600..725 630 100 Plus
X 23542271 X 18790503..18790615 272..384 565 100 Plus
X 23542271 X 18805641..18805745 1361..1465 525 100 Plus
X 23542271 X 18791146..18791244 726..824 495 100 Plus
X 23542271 X 18793758..18793847 983..1072 450 100 Plus
Blast to na_te.dros performed 2014-11-28 08:34:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6887 147..304 202 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6769..6996 70..279 198 60.6 Plus

BO07072.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:18:38 Download gff for BO07072.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 1..1452 17..1466 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:57:01 Download gff for BO07072.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 367..1815 17..1467 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:22:58 Download gff for BO07072.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 369..1817 17..1467 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:18:38 Download gff for BO07072.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 367..1819 17..1471 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:20:47 Download gff for BO07072.complete
Subject Subject Range Query Range Percent Splice Strand
Pk17E-RA 369..1817 17..1467 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:20:47 Download gff for BO07072.complete
Subject Subject Range Query Range Percent Splice Strand
X 18805641..18805745 1361..1467 98   Plus
X 18805294..18805581 1073..1360 100 -> Plus
X 18793759..18793847 984..1072 100 -> Plus
X 18791301..18791459 825..983 100 -> Plus
X 18791146..18791244 726..824 100 -> Plus
X 18790958..18791081 602..725 100 -> Plus
X 18790677..18790893 385..601 100 -> Plus
X 18790506..18790615 275..384 100 -> Plus
X 18788832..18789089 17..274 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:22:58 Download gff for BO07072.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18699674..18699778 1361..1467 98   Plus
arm_X 18699327..18699614 1073..1360 100 -> Plus
arm_X 18687792..18687880 984..1072 100 -> Plus
arm_X 18685334..18685492 825..983 100 -> Plus
arm_X 18685179..18685277 726..824 100 -> Plus
arm_X 18684991..18685114 602..725 100 -> Plus
arm_X 18684710..18684926 385..601 100 -> Plus
arm_X 18684539..18684648 275..384 100 -> Plus
arm_X 18682865..18683122 17..274 100 -> Plus

BO07072.pep Sequence

Translation from 16 to 1483

> BO07072.pep
MGNSQPRNASRSRRTSQWPQGAAELGASASDHHYHQEELYQEQQQQQQQP
QQEQPSSRRIQFQAHTNQPTQSHPPGDEEQPVQSQQQQLSTWSLGSLSGG
RLNWSFSGARNSFRHRNKATRKSLTSLHGSRRGKTQWHRPLTNSIFNSHF
KETSKNDLYRIDHLVAKGAFGVVFKVSSKSDISQCYALKVLKKSKLIEDN
SVRQIKDEADIQKVCGHHPFIVKQIDLWQNRHNLHILSEYVPNGELFSKI
THFSIDLVRLYIGEIALALDFLHNAGIIYRDAKPENILLTEQFHIKLTDF
GLSKWLKLGANTRTMCGTFKYMAPEILCGEPYGHAVDWWALGVIACQMLT
QKSPNIKRHLLRRRESVEPEDGLSNAPSIAQINGCLQDSDGDSEDFLPEE
VQHLTHEGRDVLRKLLTIEPRQRIRSVMALQRIAIYKDYNLSSKQLLSLS
PREIIARDGIRIYEDRHFDQLTNQCAIDAFLDFASFLDH

BO07072.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Pk17E-PA 483 CG7001-PA 1..483 1..483 2544 100 Plus
Pk17E-PC 481 CG7001-PC 1..481 1..483 2521 99.6 Plus
Pk17E-PB 169 CG7001-PB 1..169 315..483 889 100 Plus
S6k-PB 490 CG10539-PB 77..324 159..426 387 36.7 Plus
S6k-PA 490 CG10539-PA 77..324 159..426 387 36.7 Plus