Clone BO07155 Report

Search the DGRC for BO07155

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:71
Well:55
Vector:pDNR-Dual
Associated Gene/Transcriptyki-RD
Protein status:BO07155.pep: validated full length
Sequenced Size:1132

Clone Sequence Records

BO07155.3prime Sequence

861 bp (808 high quality bases) assembled on 2005-12-04

> BO07155.3prime
ATGGTCTAGAAAGCTTGCATTAATTTTATACCATTCCAAATCGTCAGGTT
TGTGGGAAGACGGCGGATTTACAATGGCCTGTGCGTCATTGAACAAGTTA
CTGCAAAGATTATCCTCAATCTGGAGGGAAGACACTAAGTTATCTGGGCA
GTCGAGCACGCTAAGCCCAGATTCATTCTGCTTTATTCGCTCGGCCATCA
AGATTTGCTGCTGCTGGCGATATTGGATTCTGGGATCCTCCCACTGCGTA
GATTTTGTAGTATGATTCAAGTAGTAGATCTGGCCATCATTGGTCTTGGC
TTGCTCCCATCCCGGCGGCAAGGCGCCTAGTTGGCGGTTCAACTGAATGG
GGCTGATGACGTCGTAGGAGCGCTGCTTCTTGTGCACTGTCTGCATGGAC
ATGGGAATGTCCTGCGACATGCAGGTGTTCATGGCGTCCAGATCAATGGC
CGAGCTGGCCGGGGCGCCGCTGGGGAACTCTTGGGCACTGTTCTCTGGGA
AAGTGGGCCCAGCGGGCTGCTGTTGGCTGCTCGGATTGGCATTCGGATTG
TTGGCTGCTGCTGCGTCGCTCCGGGCGCGCACATTGTAGTTCTGCTGCAG
CGAGGCGGGGCTGCTGCGGGCTCGGGAGTGATGTATCGCCAGGCGGCTGT
GCTGGGGAGACGGCTGAATCTGGAGCTGGGGGATGGCGGCGATGGGCGAC
TGGCCATCTGGCTGCTGGACGATGGACGCCTTGTTCCCGATGTTGATGCT
CGACTGGGAGCCCGCGTCGTAGGTGGAGTCGGCGCTGTTGGGCCGCGAGT
GCGAGGGCGCCGGGGGCGTGAAGAAGGAGTTGGGCAGCTTCCGCATGCGC
AGGGGCAGCTG

BO07155.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4005-PB 1101 CG4005-RB 256..1098 861..19 4190 99.8 Minus
CG4005-PA 1101 CG4005-RA 256..1098 861..19 4190 99.8 Minus
CG4005-PC 1257 CG4005-RC 256..944 861..173 3420 99.8 Minus
CG4005-PC 1257 CG4005-RC 1100..1254 173..19 775 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 20:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
yki-RD 1369 CG4005-RD 426..1268 861..19 4200 99.9 Minus
yki-RF 1525 CG4005-RF 426..1114 861..173 3430 99.9 Minus
yki-RG 1460 CG4005-RG 361..1049 861..173 3430 99.9 Minus
yki-RF 1525 CG4005-RF 1262..1424 180..19 790 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 20:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24067465..24068060 266..861 2965 99.8 Plus
2R 25286936 2R 24066076..24066180 19..123 525 100 Plus
2R 25286936 2R 24067163..24067254 174..265 460 100 Plus
2R 25286936 2R 24066261..24066314 121..174 270 100 Plus
Blast to na_te.dros performed on 2015-02-04 20:18:06 has no hits.

BO07155.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:10:53 Download gff for BO07155.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4005-PA 256..1101 15..861 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:50:29 Download gff for BO07155.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4005-PA 256..1101 15..861 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:24:12 Download gff for BO07155.3prime
Subject Subject Range Query Range Percent Splice Strand
yki-RD 426..1273 11..861 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:48:00 Download gff for BO07155.3prime
Subject Subject Range Query Range Percent Splice Strand
yki-RD 426..1273 11..861 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:48:00 Download gff for BO07155.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 24067465..24068060 266..861 99   Plus
2R 24067163..24067254 174..265 100 <- Plus
2R 24066261..24066313 121..173 100 <- Plus
2R 24066071..24066177 11..120 96 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:24:12 Download gff for BO07155.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19954988..19955583 266..861 99   Plus
arm_2R 19954686..19954777 174..265 100 <- Plus
arm_2R 19953784..19953836 121..173 100 <- Plus
arm_2R 19953594..19953700 11..120 96 <- Plus

BO07155.5prime Sequence

902 bp (796 high quality bases) assembled on 2005-12-03

> BO07155.5prime
GAAGTTATCAGTCGACATGTGCGCGTGCCTAATCGCTAAGATAATTCTAT
GTAGTTTTCGTTTGTATACAATAAGTGCCTTTTATATGTTAACGACGATG
TCAGCCAGCAGCAATACAAACAGCCTGATCGAGAAGGAGATCGACGACGA
GGACATGCTTTCGCCGATCAAGTCCAACAACCTGGTGGTGCGGGTCAACC
AGGACACGGACGACAACCTGCAGGCGCTATTCGACAGCGTCCTGAATCCG
GGTGACGCCAAGCGCCCGCTGCAGCTGCCCCTGCGCATGCGGAAGCTGCC
CAACTCCTTCTTCACGCCCCCGGCGCCCTCGCACTCGCGGGCCAACAGCG
CCGACTCCACCTACGACGCGGGCTCCCAGTCGAGCATCAACATCGGGAAC
AAGGCGTCCATCGTCCAGCAGCCAGATGGCCAGTCGCCCATCGCCGCCAT
CCCCCAGCTCCAGATTCAGCCGTCTCCCCAGCACAGCCGCCTGGCGATAC
ATCACTCCCGAGCCCGCAGCAGCCCCGCCTCGCTGCAGCAGAACTACAAT
GTGCGCGCCCGGAGCGACGCAGCAGCAGCCAACAATCCGAATGCCAATCC
GAGCAGCCAACAGCAGCCCGCTGGGCCCACTTTCCCAGAGAACAGTGCCC
AAGAGTTCCCCAGCGGCGCCCCGGCCAGCTCGGCCATTGATCTGGACGCC
ATGAACACCTGCATGTCGCAGGACATTCCCATGTCCATGCAGACAGTGCA
CAAGAAGCAGCGCTCCTACGACGTCATCAGCCCCATTCAGTTGAACCGCC
AACTAGGCGCCTTGGCGCCGGGATGGGAGCAAGCCAAGACCAATGATGGG
CAGATCTACTACTTGAATCATACTACAAAATCTACGCAGTGGGAGGATCC
CA

BO07155.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4005-PB 1101 CG4005-RB 1..886 17..902 4380 99.7 Plus
CG4005-PA 1101 CG4005-RA 1..886 17..902 4380 99.7 Plus
CG4005-PC 1257 CG4005-RC 1..886 17..902 4380 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
yki-RF 1525 CG4005-RF 171..1056 17..902 4400 99.8 Plus
yki-RD 1369 CG4005-RD 171..1056 17..902 4400 99.8 Plus
yki-RG 1460 CG4005-RG 106..991 17..902 4400 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 07:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24067465..24068315 867..17 4225 99.8 Minus
Blast to na_te.dros performed on 2015-02-12 07:10:04 has no hits.

BO07155.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:10:54 Download gff for BO07155.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4005-PA 1..885 17..901 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:50:30 Download gff for BO07155.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4005-PC 1..885 17..901 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:35:23 Download gff for BO07155.5prime
Subject Subject Range Query Range Percent Splice Strand
yki-RG 101..990 9..901 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:03:43 Download gff for BO07155.5prime
Subject Subject Range Query Range Percent Splice Strand
yki-RG 101..990 9..901 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 11:03:43 Download gff for BO07155.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 24067465..24068320 9..867 99   Minus
2R 24067221..24067254 868..901 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:35:23 Download gff for BO07155.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19954988..19955843 9..867 99   Minus
arm_2R 19954744..19954777 868..901 100 <- Minus

BO07155.complete Sequence

1132 bp (1132 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630691

> BO07155.complete
GAAGTTATCAGTCGACATGTGCGCGTGCCTAATCGCTAAGATAATTCTAT
GTAGTTTTCGTTTGTATACAATAAGTGCCTTTTATATGTTAACGACGATG
TCAGCCAGCAGCAATACAAACAGCCTGATCGAGAAGGAGATCGACGACGA
GGACATGCTTTCGCCGATCAAGTCCAACAACCTGGTGGTGCGGGTCAACC
AGGACACGGACGACAACCTGCAGGCGCTATTCGACAGCGTCCTGAATCCG
GGTGACGCCAAGCGCCCGCTGCAGCTGCCCCTGCGCATGCGGAAGCTGCC
CAACTCCTTCTTCACGCCCCCGGCGCCCTCGCACTCGCGGGCCAACAGCG
CCGACTCCACCTACGACGCGGGCTCCCAGTCGAGCATCAACATCGGGAAC
AAGGCGTCCATCGTCCAGCAGCCAGATGGCCAGTCGCCCATCGCCGCCAT
CCCCCAGCTCCAGATTCAGCCGTCTCCCCAGCACAGCCGCCTGGCGATAC
ATCACTCCCGAGCCCGCAGCAGCCCCGCCTCGCTGCAGCAGAACTACAAT
GTGCGCGCCCGGAGCGACGCAGCAGCAGCCAACAATCCGAATGCCAATCC
GAGCAGCCAACAGCAGCCCGCTGGGCCCACTTTCCCAGAGAACAGTGCCC
AAGAGTTCCCCAGCGGCGCCCCGGCCAGCTCGGCCATTGATCTGGACGCC
ATGAACACCTGCATGTCGCAGGACATTCCCATGTCCATGCAGACAGTGCA
CAAGAAGCAGCGCTCCTACGACGTCATCAGCCCCATTCAGTTGAACCGCC
AACTAGGCGCCTTGCCGCCGGGATGGGAGCAAGCCAAGACCAATGATGGC
CAGATCTACTACTTGAATCATACTACAAAATCTACGCAGTGGGAGGATCC
CAGAATCCAATATCGCCAGCAGCAGCAAATCTTGATGGCCGAGCGAATAA
AGCAGAATGAATCTGGGCTTAGCGTGCTCGACTGCCCAGATAACTTAGTG
TCTTCCCTCCAGATTGAGGATAATCTTTGCAGTAACTTGTTCAATGACGC
ACAGGCCATTGTAAATCCGCCGTCTTCCCACAAACCTGACGATTTGGAAT
GGTATAAAATTAATGCAAGCTTTCTAGACCAT

BO07155.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
yki-RD 1032 CG4005-PD 1..1029 86..1114 5145 100 Plus
yki-RF 1188 CG4005-PF 1..875 86..960 4375 100 Plus
yki-RG 1188 CG4005-PG 1..875 86..960 4375 100 Plus
yki-RF 1188 CG4005-PF 1031..1185 960..1114 775 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
yki-RD 1369 CG4005-RD 171..1268 17..1114 5490 100 Plus
yki-RF 1525 CG4005-RF 171..1114 17..960 4720 100 Plus
yki-RG 1460 CG4005-RG 106..1049 17..960 4720 100 Plus
yki-RF 1525 CG4005-RF 1270..1424 960..1114 775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24067465..24068315 867..17 4255 100 Minus
2R 25286936 2R 24066076..24066180 1114..1010 525 100 Minus
2R 25286936 2R 24067163..24067254 959..868 460 100 Minus
2R 25286936 2R 24066261..24066314 1012..959 270 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:53:52 has no hits.

BO07155.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:00:58 Download gff for BO07155.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 1..1032 86..1118 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:33:08 Download gff for BO07155.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 166..1273 9..1122 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:33:46 Download gff for BO07155.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 171..1268 17..1116 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:00:58 Download gff for BO07155.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 166..1273 9..1122 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:40:04 Download gff for BO07155.complete
Subject Subject Range Query Range Percent Splice Strand
yki-RD 171..1268 17..1116 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:40:04 Download gff for BO07155.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24067465..24068315 17..867 100   Minus
2R 24067163..24067254 868..959 100 <- Minus
2R 24066261..24066313 960..1012 100 <- Minus
2R 24066074..24066177 1013..1116 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:33:46 Download gff for BO07155.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19954988..19955838 17..867 100   Minus
arm_2R 19954686..19954777 868..959 100 <- Minus
arm_2R 19953784..19953836 960..1012 100 <- Minus
arm_2R 19953597..19953700 1013..1116 98 <- Minus

BO07155.pep Sequence

Translation from 16 to 1132

> BO07155.pep
MCACLIAKIILCSFRLYTISAFYMLTTMSASSNTNSLIEKEIDDEDMLSP
IKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFT
PPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQI
QPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQ
PAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRS
YDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYR
QQQQILMAERIKQNESGLSVLDCPDNLVSSLQIEDNLCSNLFNDAQAIVN
PPSSHKPDDLEWYKINASFLDH

BO07155.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
yki-PD 343 CG4005-PD 1..343 24..366 1778 100 Plus
yki-PF 395 CG4005-PF 1..395 24..366 1712 86.6 Plus
yki-PG 395 CG4005-PG 1..395 24..366 1712 86.6 Plus