Clone BO07171 Report

Search the DGRC for BO07171

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:71
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptRab35-RA
Protein status:BO07171.pep: validated full length
Sequenced Size:637

Clone Sequence Records

BO07171.3prime Sequence

635 bp (634 high quality bases) assembled on 2005-12-04

> BO07171.3prime
ATGGTCTAGAAAGCTTGCCCTGCAGCACTTCCCACCCTTGCTGCCCTTGG
GATTGGGCTTCAGATGGAGCGTGTCCTTCTGCTGCTCGTTGGGGGAGGTG
CGCAGCTTGTGATCGAGCACCTGTCGCGTAATCGACAAGAACATGTTCTC
CACGTTTATGTTGTCTTTGGCAGATGTCTCGAATAGCTCGATGTCCATTT
GTTTCGCAAACCGCTGCGCGTCTTCGGTAATGACCACCTTCCTGTCCGGA
TCGTCGTTCTTGTTGCCCACTAATACTTTTTTAACCACATCGCAGTTATT
CTGGATCTCCTCCAGCCAGCGGCGGACGTTCGCAAAGGATTCGCCGTTCG
TGACGTCGTAGACGACAATGACGCCGTGGGTGCCGCGGTAGTAGGTGCTG
GTGATTGTCCGGAAGCGCTCCTGCCCGGCCGTGTCCCAGATCTGCAGCTT
TACGCGCATGCCCTCGATGTCCACGGTGCGGATCTTAAAGTCCACGCCGA
TGGTGGTGATGTAACTGCCTGAGAATGTGTCGTCCGAGAACCGGATGAGC
AGCGACGACTTGCCCACGCCGCTATCGCCGATTATTAGCAACTTGAATAG
ATGATCGAAGCCGCGTGCCATGTCGACTGATAACT

BO07171.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9575-PA 606 Rab35-RA 1..603 621..19 3015 100 Minus
CG14791-PC 693 Rab27-RC 196..233 447..410 140 94.7 Minus
CG14791-PB 711 Rab27-RB 214..251 447..410 140 94.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 20:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-RB 2024 CG9575-RB 926..1528 621..19 3015 100 Minus
Rab35-RD 3348 CG9575-RD 926..1528 621..19 3015 100 Minus
Rab35-RA 2635 CG9575-RA 926..1528 621..19 3015 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 20:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20157970..20158270 270..570 1505 100 Plus
X 23542271 X 20157586..20157838 19..271 1265 100 Plus
X 23542271 X 20158895..20158947 569..621 265 100 Plus
X 23542271 X 12461504..12461623 346..465 195 77.5 Plus
Blast to na_te.dros performed on 2015-02-04 20:18:25 has no hits.

BO07171.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:11:22 Download gff for BO07171.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab35-PA 1..606 16..621 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:51:09 Download gff for BO07171.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9575-PA 1..606 16..621 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:24:16 Download gff for BO07171.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 918..1539 8..627 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:48:04 Download gff for BO07171.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 918..1539 8..627 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:48:04 Download gff for BO07171.3prime
Subject Subject Range Query Range Percent Splice Strand
X 20158896..20158955 570..627 95   Plus
X 20157970..20158269 270..569 100 <- Plus
X 20157575..20157836 8..269 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:24:16 Download gff for BO07171.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20052929..20052988 570..627 95   Plus
arm_X 20052003..20052302 270..569 100 <- Plus
arm_X 20051608..20051869 8..269 98 <- Plus

BO07171.5prime Sequence

635 bp (634 high quality bases) assembled on 2005-12-04

> BO07171.5prime
GAAGTTATCAGTCGACATGGCACGCGGCTTCGATCATCTATTCAAGTTGC
TAATAATCGGCGATAGCGGCGTGGGCAAGTCGTCGCTGCTCATCCGGTTC
TCGGACGACACATTCTCAGGCAGTTACATCACCACCATCGGCGTGGACTT
TAAGATCCGCACCGTGGACATCGAGGGCATGCGCGTAAAGCTGCAGATCT
GGGACACGGCCGGGCAGGAGCGCTTCCGGACAATCACCAGCACCTACTAC
CGCGGCACCCACGGCGTCATTGTCGTCTACGACGTCACGAACGGCGAATC
CTTTGCGAACGTCCGCCGCTGGCTGGAGGAGATCCAGAATAACTGCGATG
TGGTTAAAAAAGTATTAGTGGGCAACAAGAACGACGATCCGGACAGGAAG
GTGGTCATTACCGAAGACGCGCAGCGGTTTGCGAAACAAATGGACATCGA
GCTATTCGAGACATCTGCCAAAGACAACATAAACGTGGAGAACATGTTCT
TGTCGATTACGCGACAGGTGCTCGATCACAAGCTGCGCACCTCCCCCAAC
GAGCAGCAGAAGGACACGCTCCATCTGAAGCCCAATCCCAAGGGCAGCAA
GGGTGGGAAGTGCTGCAGGGCAAGCTTTCTAGACC

BO07171.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG9575-PA 606 Rab35-RA 1..603 17..619 3015 100 Plus
CG14791-PC 693 Rab27-RC 196..233 191..228 140 94.7 Plus
CG14791-PB 711 Rab27-RB 214..251 191..228 140 94.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-RB 2024 CG9575-RB 926..1528 17..619 3015 100 Plus
Rab35-RD 3348 CG9575-RD 926..1528 17..619 3015 100 Plus
Rab35-RA 2635 CG9575-RA 926..1528 17..619 3015 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 07:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20157970..20158270 368..68 1505 100 Minus
X 23542271 X 20157586..20157838 619..367 1265 100 Minus
X 23542271 X 20158895..20158947 69..17 265 100 Minus
X 23542271 X 12461504..12461623 292..173 195 77.5 Minus
Blast to na_te.dros performed on 2015-02-12 07:10:28 has no hits.

BO07171.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:11:23 Download gff for BO07171.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab35-PA 1..606 17..622 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:51:11 Download gff for BO07171.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9575-PA 1..606 17..622 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:35:28 Download gff for BO07171.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 918..1539 11..630 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:04:54 Download gff for BO07171.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 918..1539 11..630 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 11:04:54 Download gff for BO07171.5prime
Subject Subject Range Query Range Percent Splice Strand
X 20158896..20158955 11..68 95   Minus
X 20157970..20158269 69..368 100 <- Minus
X 20157575..20157836 369..630 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:35:28 Download gff for BO07171.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 20052929..20052988 11..68 95   Minus
arm_X 20052003..20052302 69..368 100 <- Minus
arm_X 20051608..20051869 369..630 98 <- Minus

BO07171.complete Sequence

637 bp (637 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630695

> BO07171.complete
GAAGTTATCAGTCGACATGGCACGCGGCTTCGATCATCTATTCAAGTTGC
TAATAATCGGCGATAGCGGCGTGGGCAAGTCGTCGCTGCTCATCCGGTTC
TCGGACGACACATTCTCAGGCAGTTACATCACCACCATCGGCGTGGACTT
TAAGATCCGCACCGTGGACATCGAGGGCATGCGCGTAAAGCTGCAGATCT
GGGACACGGCCGGGCAGGAGCGCTTCCGGACAATCACCAGCACCTACTAC
CGCGGCACCCACGGCGTCATTGTCGTCTACGACGTCACGAACGGCGAATC
CTTTGCGAACGTCCGCCGCTGGCTGGAGGAGATCCAGAATAACTGCGATG
TGGTTAAAAAAGTATTAGTGGGCAACAAGAACGACGATCCGGACAGGAAG
GTGGTCATTACCGAAGACGCGCAGCGGTTTGCGAAACAAATGGACATCGA
GCTATTCGAGACATCTGCCAAAGACAACATAAACGTGGAGAACATGTTCT
TGTCGATTACGCGACAGGTGCTCGATCACAAGCTGCGCACCTCCCCCAAC
GAGCAGCAGAAGGACACGCTCCATCTGAAGCCCAATCCCAAGGGCAGCAA
GGGTGGGAAGTGCTGCAGGGCAAGCTTTCTAGACCAT

BO07171.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-RB 606 CG9575-PB 1..603 17..619 3015 100 Plus
Rab35-RD 606 CG9575-PD 1..603 17..619 3015 100 Plus
Rab35-RA 606 CG9575-PA 1..603 17..619 3015 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-RB 2024 CG9575-RB 926..1528 17..619 3015 100 Plus
Rab35-RD 3348 CG9575-RD 926..1528 17..619 3015 100 Plus
Rab35-RA 2635 CG9575-RA 926..1528 17..619 3015 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20157970..20158270 368..68 1505 100 Minus
X 23542271 X 20157586..20157838 619..367 1265 100 Minus
X 23542271 X 20158895..20158947 69..17 265 100 Minus
X 23542271 X 12461504..12461623 292..173 195 77.5 Minus
Blast to na_te.dros performed on 2014-11-27 14:11:11 has no hits.

BO07171.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:55:27 Download gff for BO07171.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 1..606 17..622 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:27:51 Download gff for BO07171.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 884..1505 11..630 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:57 Download gff for BO07171.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 926..1528 17..621 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:55:27 Download gff for BO07171.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 884..1505 11..630 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:05:20 Download gff for BO07171.complete
Subject Subject Range Query Range Percent Splice Strand
Rab35-RA 926..1528 17..621 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:05:20 Download gff for BO07171.complete
Subject Subject Range Query Range Percent Splice Strand
X 20158896..20158947 17..68 100   Minus
X 20157970..20158269 69..368 100 <- Minus
X 20157583..20157836 369..621 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:57 Download gff for BO07171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20052929..20052980 17..68 100   Minus
arm_X 20052003..20052302 69..368 100 <- Minus
arm_X 20051616..20051869 369..621 99 <- Minus

BO07171.pep Sequence

Translation from 16 to 637

> BO07171.pep
MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTV
DIEGMRVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVR
RWLEEIQNNCDVVKKVLVGNKNDDPDRKVVITEDAQRFAKQMDIELFETS
AKDNINVENMFLSITRQVLDHKLRTSPNEQQKDTLHLKPNPKGSKGGKCC
RASFLDH

BO07171.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rab35-PB 201 CG9575-PB 1..201 1..201 1046 100 Plus
Rab35-PD 201 CG9575-PD 1..201 1..201 1046 100 Plus
Rab35-PA 201 CG9575-PA 1..201 1..201 1046 100 Plus
Rab35-PC 190 CG9575-PC 8..190 19..201 953 100 Plus
Rab1-PA 205 CG3320-PA 8..184 5..183 531 58.3 Plus