Clone BO07280 Report

Search the DGRC for BO07280

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:72
Well:80
Vector:pDNR-Dual
Associated Gene/Transcriptcalypso-RA
Protein status:BO07280.pep: validated full length
Sequenced Size:1447

Clone Sequence Records

BO07280.3prime Sequence

948 bp (894 high quality bases) assembled on 2005-12-04

> BO07280.3prime
ATGGTCTAGAAAGCTTGCCTTCCGTTTTCTGCACTTGTTGCGTCCCTTTC
GCCTCCTGCCTGGCGTTTTGCTTGGCGACTTGCCATTCTTAGCGGCCGCA
GCCTGCTGTTGCTGAGTCTTGGGCGTGGATGCAGTGCCTGCTGCGGTGCT
TCCGCCTGCACTGGCGGTGGTGCTCTGCTTGCTGATCCGATTGGCAGCAC
CCTGGCCACTGACCTTCTTCGACGGAAGCAAATGCTGGCTAACCAGCTCG
CCCAGGACGCCCTGGTGGGCCAGCATAGAGAGGAAAGTGCAAATGAACTT
ATCGTAGTTGTGGGTACGTCGACTGGCGTCCACCTTAAACATGTGCCTCC
GATCGTTTTCGTCAGCCAGATGCTGCTCATTGATGGCTATTTCTGTGTCC
AGGTTCTTGAGAAGCGATTGCAGGTCACGTGCGGTGAAAGCGCTCGGCTC
CAATAATGTGGTGGGTGTATCCGGACGTTGTGAGTCTCCGTTCCCCGATT
CGCCCTGCTCGTCGGCCTTTAGAAGTTTCTGCAGTGTTCCGGACACGATT
GCCTGGTTTGTGCGCAGCATCTTAAGTTTATGTGTTATGGCAATCCGCCT
GTCTGGCACTACGGCCATGAGATTGAAACGTATGTCCTGTTCGCCGGTCG
CTATTCCCAGTCGCTCAGCCATCACACGTCGGAACTTATCTGTCCAATCC
TCGCTATCCTCCCAACCGCCGTGATTCATGGGATACGGTTTCAAGCCATC
CAGCTCAAACAGTTGTCCATTGATAGGCACAAAGCTAACGAAGTGAAACG
CCTCACCCGTGAAGCGGCAACTTGAGACGCCCGCTCCCGTCCTTTCTAGA
CGGCGCCGAGCCTGCGGCATTGCGTGTGAGTTATGGGCACAGGCCAGCTC
CCGGAGTGTGCCNATAGCCAGCCCCTTGTTCTCCGGACTCATGCCTTT

BO07280.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8445-PA 1416 CG8445-RA 531..1413 901..19 4415 100 Minus
CG8445-PB 1416 CG8445-RB 531..1413 901..19 4415 100 Minus
CG8445-PA 1416 CG8445-RA 484..523 948..909 181 97.5 Minus
CG8445-PB 1416 CG8445-RB 484..523 948..909 181 97.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-RA 2147 CG8445-RA 842..1771 948..19 4594 99.7 Minus
calypso-RB 2117 CG8445-RB 812..1741 948..19 4594 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16194438..16195367 19..948 4549 99.2 Plus
Blast to na_te.dros performed on 2015-02-13 16:21:13 has no hits.

BO07280.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:14:18 Download gff for BO07280.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8445-PB 484..1416 18..948 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:55:01 Download gff for BO07280.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8445-PB 484..1416 18..948 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:11:05 Download gff for BO07280.3prime
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 812..1746 13..948 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:41:47 Download gff for BO07280.3prime
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 812..1746 13..948 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:41:47 Download gff for BO07280.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 16194433..16195367 13..948 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:11:05 Download gff for BO07280.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12081938..12082872 13..948 99   Plus

BO07280.5prime Sequence

924 bp (853 high quality bases) assembled on 2005-12-04

> BO07280.5prime
GAAGTTATCAGTCGACATGAACGCTGCTGGAGGAGGTAGTGGTGCCCAGG
CGGCCGCAGTGGCGGCAGGCAACAACAGTCTCAGCCACAATGCGCTACTT
TCCACGGCCTCAGGAGCCACCACCATGCCTATGGCCCAACTGGCAGACGG
TTGGTTGGAGCTGGAGTCCGACCCAGGTCTCTTCACACTGCTTCTCAAGG
ATTTTGGATGTCACGATGTACAGGTGGAGGAGGTGTACGACCTACAGAAA
CCCATCGAGAGTCCATATGGCTTCATATTTCTCTTCCGCTGGATCGAAGA
GCGACGCGCCAGACGCAAAATTGTGGAGACAACTGCTGAGATATTCGTCA
AGGATGAGGAGGCCATTTCCAGCATTTTCTTCGCCCAGCAGGTAGTCCCC
AATAGCTGTGCCACACACGCGTTGCTTTCGGTGCTCCTGAACTGCAACGA
GAACAATCTTCAGCTGGGCGACACCCTGAGTCGACTAAAAACCCACACCA
AAGGCATGAGTCCGGAGAACAAGGGGCTGGCTATTGGCAACACTCCGGAG
CTGGCCTGTGCCCATAACTCACACGCAATGCCGCAGGCTCGGCGCCGTCT
AGAAAGGACGGGAGCGGGCGTCTCAAGTTGCCGCTTCACGGGTGAGGCGT
TTCACTTCGTTAGCTTTGTGCCTATCAATGGACAACTGTTTGAGCTGGAT
GGCTTGAAACCGTATCCCATGAATCACGGCGGTTGGGAGGATAGCGAGGA
TTGGACAGATAAGTTCCGACGTGTGATGGCTGAGCGACTGGGAATAGCGA
CCGGCGAACAGGACATACGTTTCAATCTCATGGCCGTAGTGCCAGACAGG
CGGATTGGCATAACACATAAACTTAAGATGCTGCGCACAAACCAGGCAAT
CGTGTCCGGAACACTGCAGAAACT

BO07280.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8445-PA 1416 CG8445-RA 1..908 17..924 4515 99.8 Plus
CG8445-PB 1416 CG8445-RB 1..908 17..924 4515 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-RA 2147 CG8445-RA 359..1266 17..924 4525 99.9 Plus
calypso-RB 2117 CG8445-RB 329..1236 17..924 4525 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16194943..16195657 924..210 3560 99.9 Minus
2R 25286936 2R 16195715..16195909 211..17 975 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:07:19 has no hits.

BO07280.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:14:19 Download gff for BO07280.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8445-PB 1..908 17..924 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:55:02 Download gff for BO07280.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8445-PB 1..908 17..924 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:45:01 Download gff for BO07280.5prime
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 329..1236 17..924 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:58:13 Download gff for BO07280.5prime
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 329..1236 17..924 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:58:13 Download gff for BO07280.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 16195717..16195909 17..209 100   Minus
2R 16194943..16195657 210..924 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:45:01 Download gff for BO07280.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083222..12083414 17..209 100   Minus
arm_2R 12082448..12083162 210..924 99 <- Minus

BO07280.complete Sequence

1447 bp (1447 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630732

> BO07280.complete
GAAGTTATCAGTCGACATGAACGCTGCTGGAGGAGGTAGTGGTGCCCAGG
CGGCCGCAGTGGCGGCAGGCAACAACAGTCTCAGCCACAATGCGCTACTT
TCCACGGCCTCAGGAGCCACCACCATGCCTATGGCCCAACTGGCAGACGG
TTGGTTGGAGCTGGAGTCCGACCCAGGTCTCTTCACACTGCTTCTCAAGG
ATTTTGGATGTCACGATGTACAGGTGGAGGAGGTGTACGACCTACAGAAA
CCCATCGAGAGTCCATATGGCTTCATATTTCTCTTCCGCTGGATCGAAGA
GCGACGCGCCAGACGCAAAATTGTGGAGACAACTGCTGAGATATTCGTCA
AGGATGAGGAGGCCATTTCCAGCATTTTCTTCGCCCAGCAGGTAGTCCCC
AATAGCTGTGCCACACACGCGTTGCTTTCGGTGCTCCTGAACTGCAACGA
GAACAATCTTCAGCTGGGCGACACCCTGAGTCGACTAAAAACCCACACCA
AAGGCATGAGTCCGGAGAACAAGGGGCTGGCTATTGGCAACACTCCGGAG
CTGGCCTGTGCCCATAACTCACACGCAATGCCGCAGGCTCGGCGCCGTCT
AGAAAGGACGGGAGCGGGCGTCTCAAGTTGCCGCTTCACGGGTGAGGCGT
TTCACTTCGTTAGCTTTGTGCCTATCAATGGACAACTGTTTGAGCTGGAT
GGCTTGAAACCGTATCCCATGAATCACGGCGGTTGGGAGGATAGCGAGGA
TTGGACAGATAAGTTCCGACGTGTGATGGCTGAGCGACTGGGAATAGCGA
CCGGCGAACAGGACATACGTTTCAATCTCATGGCCGTAGTGCCAGACAGG
CGGATTGCCATAACACATAAACTTAAGATGCTGCGCACAAACCAGGCAAT
CGTGTCCGGAACACTGCAGAAACTTCTAAAGGCCGACGAGCAGGGCGAAT
CGGGGAACGGAGACTCACAACGTCCGGATACACCCACCACATTATTGGAG
CCGAGCGCTTTCACCGCACGTGACCTGCAATCGCTTCTCAAGAACCTGGA
CACAGAAATAGCCATCAATGAGCAGCATCTGGCTGACGAAAACGATCGGA
GGCACATGTTTAAGGTGGACGCCAGTCGACGTACCCACAACTACGATAAG
TTCATTTGCACTTTCCTCTCTATGCTGGCCCACCAGGGCGTCCTGGGCGA
GCTGGTTAGCCAGCATTTGCTTCCGTCGAAGAAGGTCAGTGGCCAGGGTG
CTGCCAATCGGATCAGCAAGCAGAGCACCACCGCCAGTGCAGGCGGAAGC
ACCGCAGCAGGCACTGCATCCACGCCCAAGACTCAGCAACAGCAGGCTGC
GGCCGCTAAGAATGGCAAGTCGCCAAGCAAAACGCCAGGCAGGAGGCGAA
AGGGACGCAACAAGTGCAGAAAACGGAAGGCAAGCTTTCTAGACCAT

BO07280.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-RA 1416 CG8445-PA 1..1413 17..1429 7065 100 Plus
calypso-RB 1416 CG8445-PB 1..1413 17..1429 7065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-RA 2147 CG8445-RA 359..1771 17..1429 7065 100 Plus
calypso-RB 2117 CG8445-RB 329..1741 17..1429 7065 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16194438..16195657 1429..210 6100 100 Minus
2R 25286936 2R 16195715..16195909 211..17 975 100 Minus
Blast to na_te.dros performed on 2014-11-27 23:44:07 has no hits.

BO07280.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:17:15 Download gff for BO07280.complete
Subject Subject Range Query Range Percent Splice Strand
CG8445-RB 1..1416 17..1430 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:39:24 Download gff for BO07280.complete
Subject Subject Range Query Range Percent Splice Strand
CG8445-RB 298..1715 17..1435 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:36:39 Download gff for BO07280.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 329..1741 17..1431 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:17:15 Download gff for BO07280.complete
Subject Subject Range Query Range Percent Splice Strand
CG8445-RB 298..1715 17..1435 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:07:08 Download gff for BO07280.complete
Subject Subject Range Query Range Percent Splice Strand
calypso-RB 329..1741 17..1431 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:07:08 Download gff for BO07280.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16195717..16195909 17..209 100   Minus
2R 16194436..16195657 210..1431 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:36:39 Download gff for BO07280.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083222..12083414 17..209 100   Minus
arm_2R 12081941..12083162 210..1431 99 <- Minus

BO07280.pep Sequence

Translation from 16 to 1447

> BO07280.pep
MNAAGGGSGAQAAAVAAGNNSLSHNALLSTASGATTMPMAQLADGWLELE
SDPGLFTLLLKDFGCHDVQVEEVYDLQKPIESPYGFIFLFRWIEERRARR
KIVETTAEIFVKDEEAISSIFFAQQVVPNSCATHALLSVLLNCNENNLQL
GDTLSRLKTHTKGMSPENKGLAIGNTPELACAHNSHAMPQARRRLERTGA
GVSSCRFTGEAFHFVSFVPINGQLFELDGLKPYPMNHGGWEDSEDWTDKF
RRVMAERLGIATGEQDIRFNLMAVVPDRRIAITHKLKMLRTNQAIVSGTL
QKLLKADEQGESGNGDSQRPDTPTTLLEPSAFTARDLQSLLKNLDTEIAI
NEQHLADENDRRHMFKVDASRRTHNYDKFICTFLSMLAHQGVLGELVSQH
LLPSKKVSGQGAANRISKQSTTASAGGSTAAGTASTPKTQQQQAAAAKNG
KSPSKTPGRRRKGRNKCRKRKASFLDH

BO07280.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
calypso-PA 471 CG8445-PA 1..471 1..471 2429 100 Plus
calypso-PB 471 CG8445-PB 1..471 1..471 2429 100 Plus
Uch-L5-PB 324 CG3431-PB 1..300 39..393 444 31.9 Plus
Uch-L5-PA 324 CG3431-PA 1..300 39..393 444 31.9 Plus
Uch-L5R-PA 340 CG1950-PA 15..314 36..393 433 30.9 Plus