Clone BO07291 Report

Search the DGRC for BO07291

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:72
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptRab7-RA
Protein status:BO07291.pep: validated full length
Sequenced Size:655

Clone Sequence Records

BO07291.3prime Sequence

653 bp (652 high quality bases) assembled on 2005-12-04

> BO07291.3prime
ATGGTCTAGAAAGCTTGCGCACTGACAGTTGTCAGGATTGCCAGGACGAT
TGTTTTGCGAGCCCAAGGTAATCTGATCGGGGAAATCGTTGATAACTTCA
GCCTCCGCCTCCAACTCTAACGCATTCTTGGCTATAACTTGAAACGCCAT
CTCCACGTTGATGCCCTCCTTGGCGGACGTTTCGTAGTAGGGTATATCGT
TCTTAGATTGGCACCATTGCTGCGCTCGACGCGTGGACACCTGGCGGTTG
TCCAAATCCACCTTATTGCCCAACACAACGAAGGGGAAGTGATCGGGATC
CCGTGGACTGGCCTGTATGAGGAACTCGTCGCGCCAGGAGTCGAGATTCT
TGAACGAGTTGGGCGCCGTCACATCGTAGACAAGCACGCAGCAGTCGGCT
CCGCGGTAAAACGCCACTCCAAGCGACTGGAAGCGTTCCTGACCAGCAGT
GTCCCAGATCTGCATTGTGACCACTCGGTCGTTGACCACCACCTCTTTCG
TGCAGAAATCAGCTCCGATCGTGGCTTTGTATTGGTTGGAGAAGCGTTTG
TTTACATACTGATTCATCAGAGAGGTCTTGCCCACACTGCTGTCGCCCAG
AATGATGACTTTCAGTAGGGATTTCTTACGTCCGGACATGTCGACTGATA
ACT

BO07291.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5915-PA 624 Rab7-RA 1..621 639..19 3105 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 19:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-RC 1280 CG5915-RC 150..775 644..19 3115 99.8 Minus
Rab7-RB 1269 CG5915-RB 139..764 644..19 3115 99.8 Minus
Rab7-RA 1515 CG5915-RA 185..810 644..19 3115 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 19:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23994243..23994603 462..102 1805 100 Minus
3R 32079331 3R 23993997..23994181 644..460 910 99.5 Minus
3R 32079331 3R 23994662..23994747 104..19 430 100 Minus
Blast to na_te.dros performed on 2015-02-09 19:32:17 has no hits.

BO07291.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:14:37 Download gff for BO07291.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab7-PA 1..624 15..639 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:55:24 Download gff for BO07291.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5915-PA 1..624 15..639 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 04:08:46 Download gff for BO07291.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 183..813 15..647 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:20:02 Download gff for BO07291.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 183..813 15..647 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:20:02 Download gff for BO07291.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 23994664..23994750 15..102 97   Minus
3R 23994246..23994602 103..459 100 -> Minus
3R 23993995..23994181 460..647 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 04:08:46 Download gff for BO07291.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19820386..19820472 15..102 97   Minus
arm_3R 19819968..19820324 103..459 100 -> Minus
arm_3R 19819717..19819903 460..647 98 -> Minus

BO07291.5prime Sequence

653 bp (652 high quality bases) assembled on 2005-12-04

> BO07291.5prime
GAAGTTATCAGTCGACATGTCCGGACGTAAGAAATCCCTACTGAAAGTCA
TCATTCTGGGCGACAGCAGTGTGGGCAAGACCTCTCTGATGAATCAGTAT
GTAAACAAACGCTTCTCCAACCAATACAAAGCCACGATCGGAGCTGATTT
CTGCACGAAAGAGGTGGTGGTCAACGACCGAGTGGTCACAATGCAGATCT
GGGACACTGCTGGTCAGGAACGCTTCCAGTCGCTTGGAGTGGCGTTTTAC
CGCGGAGCCGACTGCTGCGTGCTTGTCTACGATGTGACGGCGCCCAACTC
GTTCAAGAATCTCGACTCCTGGCGCGACGAGTTCCTCATACAGGCCAGTC
CACGGGATCCCGATCACTTCCCCTTCGTTGTGTTGGGCAATAAGGTGGAT
TTGGACAACCGCCAGGTGTCCACGCGTCGAGCGCAGCAATGGTGCCAATC
TAAGAACGATATACCCTACTACGAAACGTCCGCCAAGGAGGGCATCAACG
TGGAGATGGCGTTTCAAGTTATAGCCAAGAATGCGTTAGAGTTGGAGGCG
GAGGCTGAAGTTATCAACGATTTCCCCGATCAGATTACCTTGGGCTCGCA
AAACAATCGTCCTGGCAATCCTGACAACTGTCAGTGCGCAAGCTTTCTAG
ACC

BO07291.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5915-PA 624 Rab7-RA 1..621 17..637 3105 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-RC 1280 CG5915-RC 150..775 12..637 3115 99.8 Plus
Rab7-RB 1269 CG5915-RB 139..764 12..637 3115 99.8 Plus
Rab7-RA 1515 CG5915-RA 185..810 12..637 3115 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 07:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23994243..23994603 194..554 1805 100 Plus
3R 32079331 3R 23993997..23994181 12..196 910 99.5 Plus
3R 32079331 3R 23994662..23994747 552..637 430 100 Plus
Blast to na_te.dros performed on 2015-02-12 07:11:22 has no hits.

BO07291.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:14:38 Download gff for BO07291.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab7-PA 1..624 17..641 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:55:25 Download gff for BO07291.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5915-PA 1..624 17..641 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:35:37 Download gff for BO07291.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 183..813 9..641 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:07:14 Download gff for BO07291.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 183..813 9..641 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 11:07:14 Download gff for BO07291.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 23994664..23994750 554..641 97   Plus
3R 23994246..23994602 197..553 100 -> Plus
3R 23993995..23994181 9..196 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:35:37 Download gff for BO07291.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19820386..19820472 554..641 97   Plus
arm_3R 19819968..19820324 197..553 100 -> Plus
arm_3R 19819717..19819903 9..196 98 -> Plus

BO07291.complete Sequence

655 bp (655 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630738

> BO07291.complete
GAAGTTATCAGTCGACATGTCCGGACGTAAGAAATCCCTACTGAAAGTCA
TCATTCTGGGCGACAGCAGTGTGGGCAAGACCTCTCTGATGAATCAGTAT
GTAAACAAACGCTTCTCCAACCAATACAAAGCCACGATCGGAGCTGATTT
CTGCACGAAAGAGGTGGTGGTCAACGACCGAGTGGTCACAATGCAGATCT
GGGACACTGCTGGTCAGGAACGCTTCCAGTCGCTTGGAGTGGCGTTTTAC
CGCGGAGCCGACTGCTGCGTGCTTGTCTACGATGTGACGGCGCCCAACTC
GTTCAAGAATCTCGACTCCTGGCGCGACGAGTTCCTCATACAGGCCAGTC
CACGGGATCCCGATCACTTCCCCTTCGTTGTGTTGGGCAATAAGGTGGAT
TTGGACAACCGCCAGGTGTCCACGCGTCGAGCGCAGCAATGGTGCCAATC
TAAGAACGATATACCCTACTACGAAACGTCCGCCAAGGAGGGCATCAACG
TGGAGATGGCGTTTCAAGTTATAGCCAAGAATGCGTTAGAGTTGGAGGCG
GAGGCTGAAGTTATCAACGATTTCCCCGATCAGATTACCTTGGGCTCGCA
AAACAATCGTCCTGGCAATCCTGACAACTGTCAGTGCGCAAGCTTTCTAG
ACCAT

BO07291.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-RC 624 CG5915-PC 1..621 17..637 3105 100 Plus
Rab7-RB 624 CG5915-PB 1..621 17..637 3105 100 Plus
Rab7-RA 624 CG5915-PA 1..621 17..637 3105 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-RC 1280 CG5915-RC 150..775 12..637 3115 99.8 Plus
Rab7-RB 1269 CG5915-RB 139..764 12..637 3115 99.8 Plus
Rab7-RA 1515 CG5915-RA 185..810 12..637 3115 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23994243..23994603 194..554 1805 100 Plus
3R 32079331 3R 23993997..23994181 12..196 910 99.5 Plus
3R 32079331 3R 23994662..23994747 552..637 430 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:22:48 has no hits.

BO07291.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:05:44 Download gff for BO07291.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 1..624 17..641 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:04:19 Download gff for BO07291.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 181..811 9..641 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:38:22 Download gff for BO07291.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 190..810 17..639 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:05:44 Download gff for BO07291.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 181..811 9..641 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:17 Download gff for BO07291.complete
Subject Subject Range Query Range Percent Splice Strand
Rab7-RA 190..810 17..639 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:20:17 Download gff for BO07291.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23994664..23994747 554..639 97   Plus
3R 23994246..23994602 197..553 100 -> Plus
3R 23994002..23994181 17..196 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:38:22 Download gff for BO07291.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19820386..19820469 554..639 97   Plus
arm_3R 19819968..19820324 197..553 100 -> Plus
arm_3R 19819724..19819903 17..196 100 -> Plus

BO07291.pep Sequence

Translation from 16 to 655

> BO07291.pep
MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEV
VVNDRVVTMQIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLD
SWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRAQQWCQSKNDIP
YYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPG
NPDNCQCASFLDH

BO07291.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Rab7-PC 207 CG5915-PC 1..207 1..207 1091 100 Plus
Rab7-PB 207 CG5915-PB 1..207 1..207 1091 100 Plus
Rab7-PA 207 CG5915-PA 1..207 1..207 1091 100 Plus
Rab9-PA 256 CG9994-PA 8..186 4..181 382 45 Plus
Rab5-PI 219 CG3664-PI 23..217 2..205 331 39 Plus