Clone BO07362 Report

Search the DGRC for BO07362

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:73
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG8979-RA
Protein status:BO07362.pep: validated full length
Sequenced Size:844

Clone Sequence Records

BO07362.3prime Sequence

835 bp (786 high quality bases) assembled on 2005-12-04

> BO07362.3prime
ATGGTCTAGAAAGCTTGCCATGTAGTAATCGGGATTCCAATCTGGTGGGC
GCATATGATCTGGATTGATTCCACCCTGTCCCGGCCTATTCGGGTTCAGG
GGATTGAACGGGTCGAAGCGGGGCACGGGTCCCGGGCCCATATTTGGGCG
TGATGGAAAGCTGAACAGGTTACCATGACCACCGCGACCCAGTGGATCGA
GATCCCCGCGTCCAACGTCCGGAAATCCAAAAGGGCGAGGCTCGAATGCA
CTTGGAATGAAGGATCCGCCACGCCTTGGCTCGCCGATGCGCAAGGGATC
TGGATCCGATCCAATGGGGCGTGGTGAGTTGGTCGTCTGCGTGGTAACTT
CGCGCGAGTTTCCCGTGAATACAGGGTCTAGAAGCTCCCTACGGTAGCGT
TCAACAATCTCTGAGGCACTCGGCATTATGGTGGTGATGCCTCCCTTGAC
CTCAGGTACCAGGGTCTCTGGTTCTACGCAGATGTTGGATACCTTCTTAG
TGTTGATGTCCAACAGGTTGATCAGCAGGGAGCCCTCGGTGATGTGGCCC
AGCAGCAAATACAGCATCTTATCGTGCACGTAGCGCAGCGAGTACTTGGT
ATCGTCATCATTCCAGCTGTCCGGCAGCAGCTCACTGCCCTCCTCCTCCG
GCAAGGTTTTATCATCGCCAACGCCAACGCATCGGAAGTTGTAATGCTTG
GTCAAAAGAAAATGGACGAGGGCAATCAAAAGGTCTGACTTCTTGGAGAC
ATCAGCCTTAACGGTCTTGTACAGCAGATCCCAACCGTAAAAGAAATCGC
CCGTCTTGGCAGTCGACCCACTTTCCATGTCGACT

BO07362.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG8979-PA 813 CG8979-RA 1..810 828..19 4050 100 Minus
CG8979-PC 813 CG8979-RC 1..810 828..19 4050 100 Minus
CG8979-PB 813 CG8979-RB 1..810 828..19 4050 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-RF 1172 CG8979-RF 173..982 828..19 4050 100 Minus
PI31-RD 1118 CG8979-RD 119..928 828..19 4050 100 Minus
PI31-RB 1203 CG8979-RB 204..1013 828..19 4050 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 07:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11967837..11968231 266..660 1975 100 Plus
2R 25286936 2R 11967533..11967780 19..266 1240 100 Plus
2R 25286936 2R 11968284..11968451 661..828 840 100 Plus
Blast to na_te.dros performed on 2015-02-12 07:12:19 has no hits.

BO07362.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:16:28 Download gff for BO07362.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8979-PC 1..813 15..828 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:57:54 Download gff for BO07362.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8979-PB 1..813 15..828 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:35:54 Download gff for BO07362.3prime
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 197..1018 11..835 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:11:37 Download gff for BO07362.3prime
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 197..1018 11..835 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 11:11:37 Download gff for BO07362.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 11968284..11968454 661..835 97   Plus
2R 11967837..11968231 266..660 100 <- Plus
2R 11967528..11967779 11..265 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:35:54 Download gff for BO07362.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7855789..7855959 661..835 97   Plus
arm_2R 7855342..7855736 266..660 100 <- Plus
arm_2R 7855033..7855284 11..265 98 <- Plus

BO07362.5prime Sequence

842 bp (804 high quality bases) assembled on 2005-12-04

> BO07362.5prime
GAAGTTATCAGTCGACATGGAAAGTGGGTCGACTGCCAAGACGGGCGATT
TCTTTTACGGTTGGGATCTGCTGTACAAGACCGTTAAGGCTGATGTCTCC
AAGAAGTCAGACCTTTTGATTGCCCTCGTCCATTTTCTTTTGACCAAGCA
TTACAACTTCCGATGCGTTGGCGTTGGCGATGATAAAACCTTGCCGGAGG
AGGAGGGCAGTGAGCTGCTGCCGGACAGCTGGAATGATGACGATACCAAG
TACTCGCTGCGCTACGTGCACGATAAGATGCTGTATTTGCTGCTGGGCCA
CATCACCGAGGGCTCCCTGCTGATCAACCTGTTGGACATCAACACTAAGA
AGGTATCCAACATCTGCGTAGAACCAGAGACCCTGGTACCTGAGGTCAAG
GGAGGCATCACCACCATAATGCCGAGTGCCTCAGAGATTGTTGAACGCTA
CCGTAGGGAGCTTCTAGACCCTGTATTCACGGGAAACTCGCGCGAAGTTA
CCACGCAGACGACCAACTCACCACGCCCCATTGGATCGGATCCAGATCCC
TTGCGCATCGGCGAGCCAAGGCGTGGCGGATCCTTCATTCCAAGTGCATT
CGAGCCTCGCCCTTTTGGATTTCCGGACGTTGGACGCGGGGATCTCGATC
CACTGGGTCGCGGTGGTCATGGTAACCTGTTCAGCTTTCCATCACGCCCA
AATATGGGCCCGGGACCCGTGCCCCGCTTCGACCCGTTCAATCCCCTGAA
CCCGAATAGGCCGGGACAGGGTGGAATCAATCCAGATCATATGCGCCCAC
CAGATTGGAATCCCGATTACTACATGGGCAGCTTTCTAGACC

BO07362.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG8979-PA 813 CG8979-RA 1..810 17..826 4050 100 Plus
CG8979-PC 813 CG8979-RC 1..810 17..826 4050 100 Plus
CG8979-PB 813 CG8979-RB 1..810 17..826 4050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 03:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-RF 1172 CG8979-RF 173..982 17..826 4050 100 Plus
PI31-RD 1118 CG8979-RD 119..928 17..826 4050 100 Plus
PI31-RB 1203 CG8979-RB 204..1013 17..826 4050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 03:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11967837..11968231 579..185 1975 100 Minus
2R 25286936 2R 11967533..11967780 826..579 1240 100 Minus
2R 25286936 2R 11968284..11968451 184..17 840 100 Minus
Blast to na_te.dros performed on 2015-02-11 03:37:48 has no hits.

BO07362.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:16:29 Download gff for BO07362.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8979-PC 1..813 17..830 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:57:56 Download gff for BO07362.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8979-PB 1..813 17..830 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:55:35 Download gff for BO07362.5prime
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 204..1013 17..826 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:58:17 Download gff for BO07362.5prime
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 204..1013 17..826 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:58:17 Download gff for BO07362.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 11968284..11968451 17..184 100   Minus
2R 11967837..11968231 185..579 100 <- Minus
2R 11967533..11967779 580..826 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:55:35 Download gff for BO07362.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7855789..7855956 17..184 100   Minus
arm_2R 7855342..7855736 185..579 100 <- Minus
arm_2R 7855038..7855284 580..826 100 <- Minus

BO07362.complete Sequence

844 bp (844 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630760

> BO07362.complete
GAAGTTATCAGTCGACATGGAAAGTGGGTCGACTGCCAAGACGGGCGATT
TCTTTTACGGTTGGGATCTGCTGTACAAGACCGTTAAGGCTGATGTCTCC
AAGAAGTCAGACCTTTTGATTGCCCTCGTCCATTTTCTTTTGACCAAGCA
TTACAACTTCCGATGCGTTGGCGTTGGCGATGATAAAACCTTGCCGGAGG
AGGAGGGCAGTGAGCTGCTGCCGGACAGCTGGAATGATGACGATACCAAG
TACTCGCTGCGCTACGTGCACGATAAGATGCTGTATTTGCTGCTGGGCCA
CATCACCGAGGGCTCCCTGCTGATCAACCTGTTGGACATCAACACTAAGA
AGGTATCCAACATCTGCGTAGAACCAGAGACCCTGGTACCTGAGGTCAAG
GGAGGCATCACCACCATAATGCCGAGTGCCTCAGAGATTGTTGAACGCTA
CCGTAGGGAGCTTCTAGACCCTGTATTCACGGGAAACTCGCGCGAAGTTA
CCACGCAGACGACCAACTCACCACGCCCCATTGGATCGGATCCAGATCCC
TTGCGCATCGGCGAGCCAAGGCGTGGCGGATCCTTCATTCCAAGTGCATT
CGAGCCTCGCCCTTTTGGATTTCCGGACGTTGGACGCGGGGATCTCGATC
CACTGGGTCGCGGTGGTCATGGTAACCTGTTCAGCTTTCCATCACGCCCA
AATATGGGCCCGGGACCCGTGCCCCGCTTCGACCCGTTCAATCCCCTGAA
CCCGAATAGGCCGGGACAGGGTGGAATCAATCCAGATCATATGCGCCCAC
CAGATTGGAATCCCGATTACTACATGGCAAGCTTTCTAGACCAT

BO07362.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-RF 813 CG8979-PF 1..810 17..826 4050 100 Plus
PI31-RD 813 CG8979-PD 1..810 17..826 4050 100 Plus
PI31-RB 813 CG8979-PB 1..810 17..826 4050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-RF 1172 CG8979-RF 173..982 17..826 4050 100 Plus
PI31-RD 1118 CG8979-RD 119..928 17..826 4050 100 Plus
PI31-RB 1203 CG8979-RB 204..1013 17..826 4050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11967837..11968231 579..185 1975 100 Minus
2R 25286936 2R 11967533..11967780 826..579 1240 100 Minus
2R 25286936 2R 11968284..11968451 184..17 840 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:32:05 has no hits.

BO07362.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:25 Download gff for BO07362.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RB 1..813 17..830 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:18:47 Download gff for BO07362.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RB 114..928 17..834 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:56:52 Download gff for BO07362.complete
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 204..1013 17..828 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:25 Download gff for BO07362.complete
Subject Subject Range Query Range Percent Splice Strand
CG8979-RB 114..928 17..834 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:20:42 Download gff for BO07362.complete
Subject Subject Range Query Range Percent Splice Strand
PI31-RB 204..1013 17..828 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:20:42 Download gff for BO07362.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11968284..11968451 17..184 100   Minus
2R 11967837..11968231 185..579 100 <- Minus
2R 11967531..11967779 580..828 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:56:52 Download gff for BO07362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7855789..7855956 17..184 100   Minus
arm_2R 7855342..7855736 185..579 100 <- Minus
arm_2R 7855036..7855284 580..828 99 <- Minus

BO07362.pep Sequence

Translation from 16 to 844

> BO07362.pep
MESGSTAKTGDFFYGWDLLYKTVKADVSKKSDLLIALVHFLLTKHYNFRC
VGVGDDKTLPEEEGSELLPDSWNDDDTKYSLRYVHDKMLYLLLGHITEGS
LLINLLDINTKKVSNICVEPETLVPEVKGGITTIMPSASEIVERYRRELL
DPVFTGNSREVTTQTTNSPRPIGSDPDPLRIGEPRRGGSFIPSAFEPRPF
GFPDVGRGDLDPLGRGGHGNLFSFPSRPNMGPGPVPRFDPFNPLNPNRPG
QGGINPDHMRPPDWNPDYYMASFLDH

BO07362.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
PI31-PF 270 CG8979-PF 1..270 1..270 1469 100 Plus
PI31-PD 270 CG8979-PD 1..270 1..270 1469 100 Plus
PI31-PB 270 CG8979-PB 1..270 1..270 1469 100 Plus
PI31-PC 270 CG8979-PC 1..270 1..270 1469 100 Plus
PI31-PA 270 CG8979-PA 1..270 1..270 1469 100 Plus