Clone BO07419 Report

Search the DGRC for BO07419

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:74
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptSyx17-RA
Protein status:BO07419.pep: validated full length
Sequenced Size:937

Clone Sequence Records

BO07419.3prime Sequence

830 bp (829 high quality bases) assembled on 2006-01-06

> BO07419.3prime
ATGGTCTAGAAAGCTTGCTTCTGGCTTCTCTTTTAGCTCCAGTCTCTCAG
TTGACTCGCTATCCGGTTCCACCTGCTCCTCCTCGATGTTGCCATGCATT
ACATTGGGATTGGCCTTTAGCACAGAGCCACCGGTGAAGCCGAGGATGCC
ACATCCTACTGCCGCCAATCCTCCAGCTTTCATGCCCGCCACCAGACCAA
TGGGTCCTCCCACACAGGTGCCCAGAAGAGCTCCGACTACGGGGTACATG
GCCTTCTTGTAGGTGAGCGCCCGGCGCAGATTCAATTCGCCCTGCTGGAC
ATTCTCCAGAGCTTCCTCCGCATTGTCTGCTATCTTTTCCACCGCCACTG
ATTGCTCTGCAGTCAGTTGACGCATTCCCTGGAACATCCCGTGCAGATCG
TAGATCTCCTGTTGCAGGTTCTCCATCTGATCCAGGCAGGCTTGCCTCTG
CGCCAATTGGTGTTCCTCCAGCTGGAAATTGAGTTGCAGCTGGGGCATGT
GGCGGTGTGCGGGTAGACTGTTCATATCCACCTCCTGTGGCTGATTGTCC
AGATCGTCGTCGTACTGAGAACTCAAAGTGGAGGTGGGTGATTTGAGTTG
GAGCTCCGCAAATTCCTTCATGCCAGCGAAGGCAGTATCCCTGCCAGGTT
TCATTAGGTCGTCGAAACGTTCCAGATCCTCCTCCCGTACTTTTTCTCGC
AGTGCATCCATTTCCAGAAGTAGATTCTTGATCTGCTTAATGACCCTCAT
AGCATTGAGTTCCTCCTTTTTGATTTTTTGCCAGTCGCCGAGCGCCAGGC
TTTTTTCTATATTGCTGCGATGGTTTTTCA

BO07419.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7452-PA 906 Syx17-RA 92..903 830..19 4060 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-RB 1566 CG7452-RB 432..1243 830..19 4060 100 Minus
Syx17-RA 1566 CG7452-RA 432..1243 830..19 4060 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4404258..4404845 606..19 2940 100 Minus
3L 28110227 3L 4403973..4404197 830..606 1125 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:22:56 has no hits.

BO07419.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:18:01 Download gff for BO07419.3prime
Subject Subject Range Query Range Percent Splice Strand
Syx17-PA 93..906 16..829 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:59:57 Download gff for BO07419.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7452-PA 93..906 16..829 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:11:29 Download gff for BO07419.3prime
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 433..1243 19..829 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:48:27 Download gff for BO07419.3prime
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 433..1243 19..829 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:48:27 Download gff for BO07419.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 4404259..4404845 19..605 100   Minus
3L 4403974..4404197 606..829 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:11:29 Download gff for BO07419.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4404259..4404845 19..605 100   Minus
arm_3L 4403974..4404197 606..829 100 -> Minus

BO07419.5prime Sequence

910 bp (755 high quality bases) assembled on 2006-01-06

> BO07419.5prime
GAAGTTATCAGTCGACATGACGCGCGATGAGAAACTGCCACTTAAACAGG
CGGAGGTCTCCATCCAAAGGTTTCAGGATGTGGCGGTGCCCCACCATCTG
AGCCTACTGAAAAACCATCGCAGCAATATAGAAAAAAGCCTGGCGCTCGG
CGACTGGCAAAAAATCAAAAAGGAGGAACTCAATGCTATGAGGGTCATTA
AGCAGATCAAGAATCTACTTCTGGAAATGGATGCACTGCGAGAAAAAGTA
CGGGAGGAGGATCTGGAACGTTTCGACGACCTAATGAAACCTGGCAGGGA
TACTGCCTTCGCTGGCATGAAGGAATTTGCGGAGCTCCAACTCAAATCAC
CCACCTCCACTTTGAGTTCTCAGTACGACGACGATCTGGACAATCAGCCA
CAGGAGGTGGATATGAACAGTCTACCCGCACACCGCCACATGCCCCAGCT
GCAACTCAATTTCCAGCTGGAGGAACACCAATTGGCGCAGAGGCAAGCCT
GCCTGGATCAGATGGAGAACCTGCAACAGGAGATCTACGATCTGCACGGG
ATGTTCCAGGGAATGCGTCAACTGACTGCAGAGCAATCAGTGGCGGTGGA
AAAGATAGCAGACAATGCGGAGGAAGCTCTGGAGAATGTCCAGCAGGGCG
AATTGAATCTGCGCCGGGCGCTCACCTACAAGAAGGCCATGTACCCCGTA
GTCGGAGCTCTTCTGGGCACCTGTGTGGGAGGACCCATTGGTCTGGTGGC
GGGCATGAAAGCTGGAGGATTGGCGGCAGTAGGATGTGGCATCCTCGGCT
TCACCGGTGGCTCTGTGCTAAAGGCCAATCCCAATGTAATGCATGGCAAC
ATCGAGGAGGAGCAGGTGGAACCGGATAGCGAGTCAACTGAGAGACTGGA
GCTAAAAGAG

BO07419.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG7452-PA 906 Syx17-RA 1..894 17..910 4470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-RB 1566 CG7452-RB 341..1234 17..910 4470 100 Plus
Syx17-RA 1566 CG7452-RA 341..1234 17..910 4470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4404258..4404836 332..910 2895 100 Plus
3L 28110227 3L 4403950..4404197 85..332 1240 100 Plus
3L 28110227 3L 4403827..4403897 17..87 355 100 Plus
Blast to na_te.dros performed on 2015-02-13 12:53:11 has no hits.

BO07419.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:18:02 Download gff for BO07419.5prime
Subject Subject Range Query Range Percent Splice Strand
Syx17-PA 1..894 17..910 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:59:58 Download gff for BO07419.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7452-PA 1..894 17..910 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 18:05:15 Download gff for BO07419.5prime
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 325..1234 2..910 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:37:37 Download gff for BO07419.5prime
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 325..1234 2..910 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:37:37 Download gff for BO07419.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 4404259..4404836 333..910 100   Plus
3L 4403951..4404197 86..332 100 -> Plus
3L 4403811..4403895 2..85 94 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 18:05:15 Download gff for BO07419.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4404259..4404836 333..910 100   Plus
arm_3L 4403951..4404197 86..332 100 -> Plus
arm_3L 4403811..4403895 2..85 94 -> Plus

BO07419.complete Sequence

937 bp (937 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630778

> BO07419.complete
GAAGTTATCAGTCGACATGACGCGCGATGAGAAACTGCCACTTAAACAGG
CGGAGGTCTCCATCCAAAGGTTTCAGGATGTGGCGGTGCCCCACCATCTG
AGCCTACTGAAAAACCATCGCAGCAATATAGAAAAAAGCCTGGCGCTCGG
CGACTGGCAAAAAATCAAAAAGGAGGAACTCAATGCTATGAGGGTCATTA
AGCAGATCAAGAATCTACTTCTGGAAATGGATGCACTGCGAGAAAAAGTA
CGGGAGGAGGATCTGGAACGTTTCGACGACCTAATGAAACCTGGCAGGGA
TACTGCCTTCGCTGGCATGAAGGAATTTGCGGAGCTCCAACTCAAATCAC
CCACCTCCACTTTGAGTTCTCAGTACGACGACGATCTGGACAATCAGCCA
CAGGAGGTGGATATGAACAGTCTACCCGCACACCGCCACATGCCCCAGCT
GCAACTCAATTTCCAGCTGGAGGAACACCAATTGGCGCAGAGGCAAGCCT
GCCTGGATCAGATGGAGAACCTGCAACAGGAGATCTACGATCTGCACGGG
ATGTTCCAGGGAATGCGTCAACTGACTGCAGAGCAATCAGTGGCGGTGGA
AAAGATAGCAGACAATGCGGAGGAAGCTCTGGAGAATGTCCAGCAGGGCG
AATTGAATCTGCGCCGGGCGCTCACCTACAAGAAGGCCATGTACCCCGTA
GTCGGAGCTCTTCTGGGCACCTGTGTGGGAGGACCCATTGGTCTGGTGGC
GGGCATGAAAGCTGGAGGATTGGCGGCAGTAGGATGTGGCATCCTCGGCT
TCACCGGTGGCTCTGTGCTAAAGGCCAATCCCAATGTAATGCATGGCAAC
ATCGAGGAGGAGCAGGTGGAACCGGATAGCGAGTCAACTGAGAGACTGGA
GCTAAAAGAGAAGCCAGAAGCAAGCTTTCTAGACCAT

BO07419.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-RB 1041 CG7452-PB 1..903 17..919 4515 100 Plus
Syx17-RA 906 CG7452-PA 1..903 17..919 4515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-RB 1566 CG7452-RB 341..1243 17..919 4515 100 Plus
Syx17-RA 1566 CG7452-RA 341..1243 17..919 4515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4404258..4404845 332..919 2940 100 Plus
3L 28110227 3L 4403950..4404197 85..332 1240 100 Plus
3L 28110227 3L 4403827..4403897 17..87 355 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:42:12 has no hits.

BO07419.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:16:37 Download gff for BO07419.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 1..906 17..922 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:38:36 Download gff for BO07419.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 312..1230 2..919 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:34:12 Download gff for BO07419.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 341..1243 17..921 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:16:37 Download gff for BO07419.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 312..1230 2..919 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:03 Download gff for BO07419.complete
Subject Subject Range Query Range Percent Splice Strand
Syx17-RA 341..1243 17..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:40:03 Download gff for BO07419.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4404259..4404845 333..921 99   Plus
3L 4403951..4404197 86..332 100 -> Plus
3L 4403827..4403895 17..85 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:34:12 Download gff for BO07419.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4404259..4404845 333..921 99   Plus
arm_3L 4403951..4404197 86..332 100 -> Plus
arm_3L 4403827..4403895 17..85 100 -> Plus

BO07419.pep Sequence

Translation from 16 to 937

> BO07419.pep
MTRDEKLPLKQAEVSIQRFQDVAVPHHLSLLKNHRSNIEKSLALGDWQKI
KKEELNAMRVIKQIKNLLLEMDALREKVREEDLERFDDLMKPGRDTAFAG
MKEFAELQLKSPTSTLSSQYDDDLDNQPQEVDMNSLPAHRHMPQLQLNFQ
LEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADN
AEEALENVQQGELNLRRALTYKKAMYPVVGALLGTCVGGPIGLVAGMKAG
GLAAVGCGILGFTGGSVLKANPNVMHGNIEEEQVEPDSESTERLELKEKP
EASFLDH

BO07419.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Syx17-PA 301 CG7452-PA 1..301 1..301 1534 100 Plus
Syx17-PB 346 CG7452-PB 1..301 1..301 1534 100 Plus