Clone BO07456 Report

Search the DGRC for BO07456

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:74
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG6330-RA
Protein status:BO07456.pep: validated full length
Sequenced Size:1138

Clone Sequence Records

BO07456.3prime Sequence

909 bp (809 high quality bases) assembled on 2006-01-06

> BO07456.3prime
ATGGTCTAGAAAGCTTGCCTCGTGGGCCTGAGACTCCTGCTGGACGAGCT
TGAAGCGCCGGGGTGACTTGATGGATCCCTGGTGTCCGAATAGCGCCTTC
AGCTGTCCATTGTGCGTAAGGACCTTGCGAATATAGCGCGACACGAGGAT
CTGCGGACGCGCTTGCCACTCGTTCATGACCTCCTTGGGCGCGTTGACCT
GATCCCCATTGAGGCGGTTCAGCAGGGCGACACACACCACCGCTGCCTTG
ATGCCGGCATGGTGGGTCAGGGCCGCAAAGATGGTGCTCTCCATCTCGAT
GTTGACCACGCCGTTCTCGCGCAGCTTCTCCAGATAGGCCATCTTCTCGT
TCTCGCTGAAATCACAGAATGCGCCGTCCAAACGACCCTGGCCCTCGTAG
AAATCGTTGGTGCACAGCGTCTTGCCAATAATGGTATCGTACGGATCATC
GGGACTGGCCAGGGACTTTAGCTCACGGGCCAGCTTTTTGTCCAGCTTGG
CAGGACGATGGATGGTCTTGCCGAGAATGGTAAACTCATGGGAGTTCCTC
AGCTGCCCATCGAGGGCATCTTCGGTGATGATGACGGTGCCGCCGTCGAC
GCCAATTCCTCCGCACGTTCCTATCCTGATGAAGACGGGATCCTTGCACT
TGGCGTGGTACATCAGCTTGATCATCTCATGCATCAGGATGCTGACCGAG
GGCGTACCCATGCCATGGCTGACGCACAGCACCGGTCCCACTTTGTACAT
GGAGTAGCGATACGAATAGGCGCTGATGTCCTGCAGCTGGGTGCCCGCTG
GCAACTTGTAGCCAATCTCGTTCATTATGAAATGGGCAAATTCTCCATGC
GCTTTGGTGTGCCGCCCATGCAAACGAACTTAACGTCGCCAAACATCTCC
TGCAGGTCG

BO07456.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PB 1044 CG6330-RB 220..1041 840..19 4110 100 Minus
CG6330-PA 1107 CG6330-RA 283..1104 840..19 4110 100 Minus
CG6330-PB 1044 CG6330-RB 150..221 909..838 360 100 Minus
CG6330-PA 1107 CG6330-RA 213..284 909..838 360 100 Minus
CG3788-PA 1137 CG3788-RA 472..518 672..626 185 95.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RA 1541 CG6330-RA 345..1236 909..19 4435 99.9 Minus
CG6330-RB 2075 CG6330-RB 448..1339 909..19 4435 99.9 Minus
CG3788-RB 1758 CG3788-RB 928..1104 754..578 345 79.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 14:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26950638..26951009 160..531 1860 100 Plus
3R 32079331 3R 26951072..26951428 532..887 1705 99.2 Plus
3R 32079331 3R 26950428..26950569 19..160 710 100 Plus
2R 25286936 2R 22932746..22932922 578..754 345 79.7 Plus
Blast to na_te.dros performed on 2015-02-12 14:09:03 has no hits.

BO07456.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:19:08 Download gff for BO07456.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-PB 150..1044 15..909 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:01:30 Download gff for BO07456.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-PA 213..1107 15..909 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:05:25 Download gff for BO07456.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 448..1342 15..909 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:34:42 Download gff for BO07456.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-RB 448..1342 15..909 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:34:42 Download gff for BO07456.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 26951775..26951805 879..909 100   Plus
3R 26951072..26951419 532..878 99 <- Plus
3R 26950638..26951009 160..531 100 <- Plus
3R 26950424..26950568 15..159 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:05:25 Download gff for BO07456.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22777497..22777527 879..909 100   Plus
arm_3R 22776794..22777141 532..878 99 <- Plus
arm_3R 22776360..22776731 160..531 100 <- Plus
arm_3R 22776146..22776290 15..159 98 <- Plus

BO07456.5prime Sequence

935 bp (829 high quality bases) assembled on 2006-01-06

> BO07456.5prime
GAAGTTATCAGTCGACATGCCGCCCACCATAACCGATAATCAGACGCACG
ACTTTAAGGCCCACTACGATTGCGCCCACAGGTCCTCGCTGCAGGACGAC
GAGACGGACGATGCGTACGTGAAAAGGATAACGCGGTACTCCGATGGAAC
CGTCAAATTGCGCAACTCGAACATTGAGCTCATGGACCAGGATATCCTCT
ATCACCTGGCCTTGGGCAGCGAGAGCCACGACCTGCAGGAGATGTTTGGC
GACGTTAAGTTCGTTTGCATGGGCGGCACACCAAAGCGCATGGAGAATTT
TGCCCATTTCATAATGAACGAGATTGGCTACAAGTTGCCAGCGGGCACCC
AGCTGCAGGACATCAGCGCCTATTCGTATCGCTACTCCATGTACAAAGTG
GGACCGGTGCTGTGCGTCAGCCATGGCATGGGTACGCCCTCGGTCAGCAT
CCTGATGCATGAGATGATCAAGCTGATGTACCACGCCAAGTGCAAGGATC
CCGTCTTCATCAGGATAGGAACGTGCGGAGGAATTGGCGTCGACGGCGGC
ACCGTCATCATCACCGAAGATGCCCTCGATGGGCAGCTGAGGAACTCCCA
TGAGTTTACCATTCTCGGCAAGACCATCCATCGTCCTGCCAAGCTGGACA
AAAAGCTGGCCCGTGAGCTAAAGTCCCTGGCCAGTCCCGATGATCCGTAC
GATACCATTATTGGCAAGACGCTGTGCACCAACGATTTCTACGAGGGCCA
GGGTCGTTTGGACGGCGCATTCTGTGATTTCAGCGAGAACGAGAAGATGG
CCTATCTGGAGAAGCTGCGCGAGAACGGCGTGGTCAACATCGAGATGGAG
AGCACCATCTTTGCGGCCCTGACCAACCATGCCGGCATCAAGGCAGCGGT
GGTGTGTGTCGCCCTGCTGAACCCGCCTCATGGGG

BO07456.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PA 1107 CG6330-RA 1..907 17..923 4510 99.8 Plus
CG6330-PB 1044 CG6330-RB 57..844 136..923 3915 99.8 Plus
CG3788-PA 1137 CG3788-RA 472..518 467..513 185 95.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RA 1541 CG6330-RA 132..1051 16..935 4540 99.7 Plus
CG6330-RB 2075 CG6330-RB 355..1154 136..935 3940 99.6 Plus
CG3788-RB 1758 CG3788-RB 928..1104 385..561 345 79.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26951072..26951428 607..251 1755 99.4 Minus
3R 32079331 3R 26950694..26951009 923..608 1565 99.7 Minus
3R 32079331 3R 26951775..26951899 259..135 625 100 Minus
3R 32079331 3R 26953001..26953123 138..16 615 100 Minus
2R 25286936 2R 22932746..22932922 561..385 345 79.7 Minus
Blast to na_te.dros performed 2015-02-13 01:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 200..283 263..181 111 60.7 Minus
Tabor 7345 Tabor TABOR 7345bp 7039..7122 263..181 111 60.7 Minus

BO07456.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:19:10 Download gff for BO07456.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-PA 1..919 17..935 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:01:32 Download gff for BO07456.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-PA 1..919 17..935 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:32:37 Download gff for BO07456.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 132..1051 16..935 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:18:21 Download gff for BO07456.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 132..1051 16..935 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:18:21 Download gff for BO07456.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 26953004..26953123 16..135 100   Minus
3R 26951775..26951898 136..259 100 <- Minus
3R 26951072..26951419 260..607 100 <- Minus
3R 26950682..26951009 608..935 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:32:37 Download gff for BO07456.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22778726..22778845 16..135 100   Minus
arm_3R 22777497..22777620 136..259 100 <- Minus
arm_3R 22776794..22777141 260..607 100 <- Minus
arm_3R 22776404..22776731 608..935 99 <- Minus

BO07456.complete Sequence

1138 bp (1138 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630792

> BO07456.complete
GAAGTTATCAGTCGACATGCCGCCCACCATAACCGATAATCAGACGCACG
ACTTTAAGGCCCACTACGATTGCGCCCACAGGTCCTCGCTGCAGGACGAC
GAGACGGACGATGCGTACGTGAAAAGGATAACGCGGTACTCCGATGGAAC
CGTCAAATTGCGCAACTCGAACATTGAGCTCATGGACCAGGATATCCTCT
ATCACCTGGCCTTGGGCAGCGAGAGCCACGACCTGCAGGAGATGTTTGGC
GACGTTAAGTTCGTTTGCATGGGCGGCACACCAAAGCGCATGGAGAATTT
TGCCCATTTCATAATGAACGAGATTGGCTACAAGTTGCCAGCGGGCACCC
AGCTGCAGGACATCAGCGCCTATTCGTATCGCTACTCCATGTACAAAGTG
GGACCGGTGCTGTGCGTCAGCCATGGCATGGGTACGCCCTCGGTCAGCAT
CCTGATGCATGAGATGATCAAGCTGATGTACCACGCCAAGTGCAAGGATC
CCGTCTTCATCAGGATAGGAACGTGCGGAGGAATTGGCGTCGACGGCGGC
ACCGTCATCATCACCGAAGATGCCCTCGATGGGCAGCTGAGGAACTCCCA
TGAGTTTACCATTCTCGGCAAGACCATCCATCGTCCTGCCAAGCTGGACA
AAAAGCTGGCCCGTGAGCTAAAGTCCCTGGCCAGTCCCGATGATCCGTAC
GATACCATTATTGGCAAGACGCTGTGCACCAACGATTTCTACGAGGGCCA
GGGTCGTTTGGACGGCGCATTCTGTGATTTCAGCGAGAACGAGAAGATGG
CCTATCTGGAGAAGCTGCGCGAGAACGGCGTGGTCAACATCGAGATGGAG
AGCACCATCTTTGCGGCCCTGACCCACCATGCCGGCATCAAGGCAGCGGT
GGTGTGTGTCGCCCTGCTGAACCGCCTCAATGGGGATCAGGTCAACGCGC
CCAAGGAGGTCATGAACGAGTGGCAAGCGCGTCCGCAGATCCTCGTGTCG
CGCTATATTCGCAAGGTCCTTACGCACAATGGACAGCTGAAGGCGCTATT
CGGACACCAGGGATCCATCAAGTCACCCCGGCGCTTCAAGCTCGTCCAGC
AGGAGTCTCAGGCCCACGAGGCAAGCTTTCTAGACCAT

BO07456.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RA 1107 CG6330-PA 1..1104 17..1120 5520 100 Plus
CG6330-RB 1044 CG6330-PB 57..1041 136..1120 4925 100 Plus
CG3788-RB 1137 CG3788-PB 390..566 385..561 345 79.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-RA 1541 CG6330-RA 132..1236 16..1120 5525 100 Plus
CG6330-RB 2075 CG6330-RB 355..1339 136..1120 4925 100 Plus
CG3788-RB 1758 CG3788-RB 928..1104 385..561 345 79.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26950638..26951009 979..608 1860 100 Minus
3R 32079331 3R 26951072..26951428 607..251 1755 99.4 Minus
3R 32079331 3R 26950428..26950569 1120..979 710 100 Minus
3R 32079331 3R 26951775..26951899 259..135 625 100 Minus
3R 32079331 3R 26953001..26953123 138..16 615 100 Minus
2R 25286936 2R 22932746..22932922 561..385 345 79.7 Minus
Blast to na_te.dros performed 2014-11-27 16:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 200..283 263..181 111 60.7 Minus
Tabor 7345 Tabor TABOR 7345bp 7039..7122 263..181 111 60.7 Minus

BO07456.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:16:33 Download gff for BO07456.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 1..1107 17..1124 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:38:30 Download gff for BO07456.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 130..1237 16..1124 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:53:44 Download gff for BO07456.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 133..1236 17..1122 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:16:33 Download gff for BO07456.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 130..1237 16..1124 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:09:53 Download gff for BO07456.complete
Subject Subject Range Query Range Percent Splice Strand
CG6330-RA 133..1236 17..1122 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:09:53 Download gff for BO07456.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26953004..26953122 17..135 100   Minus
3R 26951775..26951898 136..259 100 <- Minus
3R 26951072..26951419 260..607 100 <- Minus
3R 26950638..26951009 608..979 100 <- Minus
3R 26950426..26950568 980..1122 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:44 Download gff for BO07456.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22778726..22778844 17..135 100   Minus
arm_3R 22777497..22777620 136..259 100 <- Minus
arm_3R 22776794..22777141 260..607 100 <- Minus
arm_3R 22776360..22776731 608..979 100 <- Minus
arm_3R 22776148..22776290 980..1122 98 <- Minus

BO07456.pep Sequence

Translation from 16 to 1138

> BO07456.pep
MPPTITDNQTHDFKAHYDCAHRSSLQDDETDDAYVKRITRYSDGTVKLRN
SNIELMDQDILYHLALGSESHDLQEMFGDVKFVCMGGTPKRMENFAHFIM
NEIGYKLPAGTQLQDISAYSYRYSMYKVGPVLCVSHGMGTPSVSILMHEM
IKLMYHAKCKDPVFIRIGTCGGIGVDGGTVIITEDALDGQLRNSHEFTIL
GKTIHRPAKLDKKLARELKSLASPDDPYDTIIGKTLCTNDFYEGQGRLDG
AFCDFSENEKMAYLEKLRENGVVNIEMESTIFAALTHHAGIKAAVVCVAL
LNRLNGDQVNAPKEVMNEWQARPQILVSRYIRKVLTHNGQLKALFGHQGS
IKSPRRFKLVQQESQAHEASFLDH

BO07456.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6330-PA 368 CG6330-PA 1..368 1..368 1939 100 Plus
CG6330-PB 347 CG6330-PB 10..347 23..368 1724 96 Plus
CG3788-PB 378 CG3788-PB 57..346 50..338 928 59 Plus
CG3788-PA 378 CG3788-PA 57..346 50..338 928 59 Plus
CG17224-PD 300 CG17224-PD 2..298 42..335 693 45.2 Plus