Clone BO07462 Report

Search the DGRC for BO07462

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:74
Well:62
Vector:pDNR-Dual
Associated Gene/Transcriptcpa-RA
Protein status:BO07462.pep: validated full length
Sequenced Size:892

Clone Sequence Records

BO07462.3prime Sequence

890 bp (820 high quality bases) assembled on 2006-01-06

> BO07462.3prime
ATGGTCTAGAAAGCTTGCTTGCGTCTTCAGTTCCTTGCCAATGCTGTACG
AGACGATTTTGCTCCAGTCGATCTTGGTCCTGGTGATGGGCAACTGGCGA
CGCATTGCCTTGAATGTCGTGTCCGACATCGTCTGATAGTTCTCCGAAAT
GGCCAGCTGGTACTCATTCTCGGCGTCCTCGATCAGACGGATCACCTCCT
TGGCCACCTGCTGCTCGTTGCTGACCACCACGCTTTCGCGGCACTCCTTT
GAGGACACCAGCTGGACGTTGCCGTCCTCGTAGTAATGCACCTGCACCTT
GAGCACACCCTTCAGTTCGGCGGTTCCGCTGCCCGCCTGGAAGGTCACAT
GCCACTGGGAGCGCCATCGGCCATTCCAATAGTTCTTCGGCTGGAACTGG
TGGTCTTCGATGCAAATGGTCAGGGTGATCTGGTTGCCCTGCGCCTTTCC
AAAAACAGAGCTGACCCCGTGTCTATAATGACTGGCAGTGTAGGCGAGCG
TCTCCAGGTCGAGGGCCGCCCTCCAGGGCTCCGCAGTGGCATCTGCCTCT
ACGTCCTGGTAGTCGGAAGCCTCTTTTCGGAGGTGGTCGTATTTGAAGGC
TTGCTTTGTGCGCGGGTCGTAGAAGCGACCGTTTCCCAGATCGTTGTGTT
CCGATATGATGGCGTTATGATCGGTGCCCTCGATGCGAACCGGAGTCAGC
TGGTCCTTGTTGTATTGGGCGAAGGCGTGGCTAGCCCCATCCTTTAGCAG
AGTGTCATTCTTGAGGAGCTCCCGCACATCGTTGAACACTTCGTTGAACT
CGCCGGGCGGCGCATGTAGGATGAAGTCCGATACGATGCGCACCTTCTCC
GCATCGGTGATCGGTGTCTGCTCCATGTCGACTGATAACT

BO07462.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG10540-PA 861 CG10540-RA 1..858 876..19 4290 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-RA 1918 CG10540-RA 236..1093 876..19 4290 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21058611..21059058 466..19 2240 100 Minus
2R 25286936 2R 21058022..21058263 876..635 1210 100 Minus
2R 25286936 2R 21058383..21058555 636..464 865 100 Minus
Blast to na_te.dros performed on 2015-02-11 17:21:39 has no hits.

BO07462.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:19:20 Download gff for BO07462.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10540-PA 1..861 15..876 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:01:47 Download gff for BO07462.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10540-PA 1..861 15..876 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:43:24 Download gff for BO07462.3prime
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 226..1097 14..884 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:05:45 Download gff for BO07462.3prime
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 226..1097 14..884 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:05:45 Download gff for BO07462.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 21058612..21059062 14..465 99   Minus
2R 21058384..21058553 466..635 100 -> Minus
2R 21058012..21058262 636..884 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:43:24 Download gff for BO07462.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16946117..16946567 14..465 99   Minus
arm_2R 16945889..16946058 466..635 100 -> Minus
arm_2R 16945517..16945767 636..884 98 -> Minus

BO07462.5prime Sequence

890 bp (881 high quality bases) assembled on 2006-01-06

> BO07462.5prime
GAAGTTATCAGTCGACATGGAGCAGACACCGATCACCGATGCGGAGAAGG
TGCGCATCGTATCGGACTTCATCCTACATGCGCCGCCCGGCGAGTTCAAC
GAAGTGTTCAACGATGTGCGGGAGCTCCTCAAGAATGACACTCTGCTAAA
GGATGGGGCTAGCCACGCCTTCGCCCAATACAACAAGGACCAGCTGACTC
CGGTTCGCATCGAGGGCACCGATCATAACGCCATCATATCGGAACACAAC
GATCTGGGAAACGGTCGCTTCTACGACCCGCGCACAAAGCAAGCCTTCAA
ATACGACCACCTCCGAAAAGAGGCTTCCGACTACCAGGACGTAGAGGCAG
ATGCCACTGCGGAGCCCTGGAGGGCGGCCCTCGACCTGGAGACGCTCGCC
TACACTGCCAGTCATTATAGACACGGGGTCAGCTCTGTTTTTGGAAAGGC
GCAGGGCAACCAGATCACCCTGACCATTTGCATCGAAGACCACCAGTTCC
AGCCGAAGAACTATTGGAATGGCCGATGGCGCTCCCAGTGGCATGTGACC
TTCCAGGCGGGCAGCGGAACCGCCGAACTGAAGGGTGTGCTCAAGGTGCA
GGTGCATTACTACGAGGACGGCAACGTCCAGCTGGTGTCCTCAAAGGAGT
GCCGCGAAAGCGTGGTGGTCAGCAACGAGCAGCAGGTGGCCAAGGAGGTG
ATCCGTCTGATCGAGGACGCCGAGAATGAGTACCAGCTGGCCATTTCGGA
GAACTATCAGACGATGTCGGACACGACATTCAAGGCAATGCGTCGCCAGT
TGCCCATCACCAGGACCAAGATCGACTGGAGCAAAATCGTCTCGTACAGC
ATTGGCAAGGAACTGAAGACGCAAGCAAGCTTTCTAGAAC

BO07462.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG10540-PA 861 CG10540-RA 1..858 17..874 4290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 21:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-RA 1918 CG10540-RA 236..1093 17..874 4290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 21:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21058611..21059058 427..874 2240 100 Plus
2R 25286936 2R 21058022..21058263 17..258 1210 100 Plus
2R 25286936 2R 21058383..21058555 257..429 865 100 Plus
Blast to na_te.dros performed on 2015-02-11 21:57:00 has no hits.

BO07462.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:19:21 Download gff for BO07462.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10540-PA 1..861 17..878 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:01:49 Download gff for BO07462.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10540-PA 1..861 17..878 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:45:34 Download gff for BO07462.5prime
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 226..1097 9..879 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:48:09 Download gff for BO07462.5prime
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 226..1097 9..879 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:48:09 Download gff for BO07462.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 21058612..21059062 428..879 99   Plus
2R 21058384..21058553 258..427 100 -> Plus
2R 21058012..21058262 9..257 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:45:34 Download gff for BO07462.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16946117..16946567 428..879 99   Plus
arm_2R 16945889..16946058 258..427 100 -> Plus
arm_2R 16945517..16945767 9..257 98 -> Plus

BO07462.complete Sequence

892 bp (892 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630796

> BO07462.complete
GAAGTTATCAGTCGACATGGAGCAGACACCGATCACCGATGCGGAGAAGG
TGCGCATCGTATCGGACTTCATCCTACATGCGCCGCCCGGCGAGTTCAAC
GAAGTGTTCAACGATGTGCGGGAGCTCCTCAAGAATGACACTCTGCTAAA
GGATGGGGCTAGCCACGCCTTCGCCCAATACAACAAGGACCAGCTGACTC
CGGTTCGCATCGAGGGCACCGATCATAACGCCATCATATCGGAACACAAC
GATCTGGGAAACGGTCGCTTCTACGACCCGCGCACAAAGCAAGCCTTCAA
ATACGACCACCTCCGAAAAGAGGCTTCCGACTACCAGGACGTAGAGGCAG
ATGCCACTGCGGAGCCCTGGAGGGCGGCCCTCGACCTGGAGACGCTCGCC
TACACTGCCAGTCATTATAGACACGGGGTCAGCTCTGTTTTTGGAAAGGC
GCAGGGCAACCAGATCACCCTGACCATTTGCATCGAAGACCACCAGTTCC
AGCCGAAGAACTATTGGAATGGCCGATGGCGCTCCCAGTGGCATGTGACC
TTCCAGGCGGGCAGCGGAACCGCCGAACTGAAGGGTGTGCTCAAGGTGCA
GGTGCATTACTACGAGGACGGCAACGTCCAGCTGGTGTCCTCAAAGGAGT
GCCGCGAAAGCGTGGTGGTCAGCAACGAGCAGCAGGTGGCCAAGGAGGTG
ATCCGTCTGATCGAGGACGCCGAGAATGAGTACCAGCTGGCCATTTCGGA
GAACTATCAGACGATGTCGGACACGACATTCAAGGCAATGCGTCGCCAGT
TGCCCATCACCAGGACCAAGATCGACTGGAGCAAAATCGTCTCGTACAGC
ATTGGCAAGGAACTGAAGACGCAAGCAAGCTTTCTAGACCAT

BO07462.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-RA 861 CG10540-PA 1..858 17..874 4290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-RA 1918 CG10540-RA 236..1093 17..874 4290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21058611..21059058 427..874 2240 100 Plus
2R 25286936 2R 21058022..21058263 17..258 1210 100 Plus
2R 25286936 2R 21058383..21058555 257..429 865 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:58:48 has no hits.

BO07462.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:16:17 Download gff for BO07462.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 1..861 17..878 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:38:09 Download gff for BO07462.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 222..1093 9..879 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:00:13 Download gff for BO07462.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 236..1093 17..876 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:16:17 Download gff for BO07462.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 222..1093 9..879 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:31:36 Download gff for BO07462.complete
Subject Subject Range Query Range Percent Splice Strand
cpa-RA 236..1093 17..876 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:31:36 Download gff for BO07462.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21058612..21059058 428..876 99   Plus
2R 21058384..21058553 258..427 100 -> Plus
2R 21058022..21058262 17..257 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:00:13 Download gff for BO07462.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16946117..16946563 428..876 99   Plus
arm_2R 16945889..16946058 258..427 100 -> Plus
arm_2R 16945527..16945767 17..257 100 -> Plus

BO07462.pep Sequence

Translation from 16 to 892

> BO07462.pep
MEQTPITDAEKVRIVSDFILHAPPGEFNEVFNDVRELLKNDTLLKDGASH
AFAQYNKDQLTPVRIEGTDHNAIISEHNDLGNGRFYDPRTKQAFKYDHLR
KEASDYQDVEADATAEPWRAALDLETLAYTASHYRHGVSSVFGKAQGNQI
TLTICIEDHQFQPKNYWNGRWRSQWHVTFQAGSGTAELKGVLKVQVHYYE
DGNVQLVSSKECRESVVVSNEQQVAKEVIRLIEDAENEYQLAISENYQTM
SDTTFKAMRRQLPITRTKIDWSKIVSYSIGKELKTQASFLDH

BO07462.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
cpa-PA 286 CG10540-PA 1..286 1..286 1500 100 Plus