Clone BO07547 Report

Search the DGRC for BO07547

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:75
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptRab6-RA
Protein status:BO07547.pep: validated full length
Sequenced Size:658

Clone Sequence Records

BO07547.3prime Sequence

656 bp (655 high quality bases) assembled on 2006-01-06

> BO07547.3prime
ATGGTCTAGAAAGCTTGCGCAGGCGCAGCCGCCCTCGGGATCCTTTGTCT
CGTTGGGTGAGTCCTTTAGCACAACCTCCTGCATGTCCTCGGAGGGCTTG
TTCTCCGTGGAATCCATGCCGGGCAGTGCCGCGGCCACCCGTCGGAACAA
TTGCTTCACATTGTAGCCGGCCTTGGCGCTTGTCTCGATGAACATCACGT
TAAGCTCCTTCGCCTTGCGCTCACCCTCCTCGGTGGACACCTGACGCTTG
TCGGAGAGATCCGTCTTGTTGCCCACCAGCATGATGATGACGTCGCTACC
CCGCTCCGTGCGCACGTCATCGATCCACTTGGAGGTCTGGTGGAACGAGT
TGGTGTTGGTGATATCGTAAACGACCACTGCCACCGTGGAGTCGCGTATG
TACGAGGGTATCAGCGAGCGGAATCGCTCCTGTCCCGCCGTATCCCACAG
CTGCAGGCGCACAGTGCGATCCTCCAGGTACATGGTCTTCGATAGGAAAT
CAATTCCGATCGTCGCCTGGTACGTGTTGTCGAAGCTGTCGTACATGAAG
CGCGTAATCAGCGAGGTCTTGCCCACACTCTGCTCGCCGAGGAAGACGAG
CTTGAACTTCCGCAGCGGATTGCCAAAATCTCCGGATGACATGTCGACTG
ATAACT

BO07547.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6601-PA 627 Rab6-RA 1..624 642..19 3120 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 20:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-RB 1896 CG6601-RB 318..941 642..19 3120 100 Minus
Rab6-RA 1830 CG6601-RA 318..941 642..19 3120 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 20:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12108176..12108799 19..642 3120 100 Plus
Blast to na_te.dros performed on 2015-02-04 20:25:58 has no hits.

BO07547.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:21:58 Download gff for BO07547.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab6-PA 1..627 18..642 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:05:33 Download gff for BO07547.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6601-PA 1..627 18..642 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:25:28 Download gff for BO07547.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 312..941 19..649 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:49:33 Download gff for BO07547.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 312..941 19..649 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:49:33 Download gff for BO07547.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 12108176..12108805 19..649 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:25:28 Download gff for BO07547.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12108176..12108805 19..649 99   Plus

BO07547.5prime Sequence

656 bp (655 high quality bases) assembled on 2006-01-06

> BO07547.5prime
GAAGTTATCAGTCGACATGTCATCCGGAGATTTTGGCAATCCGCTGCGGA
AGTTCAAGCTCGTCTTCCTCGGCGAGCAGAGTGTGGGCAAGACCTCGCTG
ATTACGCGCTTCATGTACGACAGCTTCGACAACACGTACCAGGCGACGAT
CGGAATTGATTTCCTATCGAAGACCATGTACCTGGAGGATCGCACTGTGC
GCCTGCAGCTGTGGGATACGGCGGGACAGGAGCGATTCCGCTCGCTGATA
CCCTCGTACATACGCGACTCCACGGGGGCAGTGGTCGTTTACGATATCAC
CAACACCAACTCGTTCCACCAGACCTCCAAGTGGATCGATGACGTGCGCA
CGGAGCGGGGTAGCGACGTCATCATCATGCTGGTGGGCAACAAGACGGAT
CTCTCCGACAAGCGTCAGGTGTCCACCGAGGAGGGTGAGCGCAAGGCGAA
GGAGCTTAACGTGATGTTCATCGAGACAAGCGCCAAGGCCGGCTACAATG
TGAAGCAATTGTTCCGACGGGTGGCCGCGGCACTGCCCGGCATGGATTCC
ACGGAGAACAAGCCCTCCGAGGACATGCAGGAGGTTGTGCTAAAGGACTC
ACCCAACGAGACAAAGGATCCCGAGGGCGGCTGCGCCTGCGCAAGCTTTC
TAGACC

BO07547.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6601-PA 627 Rab6-RA 1..624 17..640 3095 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 19:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-RB 1896 CG6601-RB 318..941 17..640 3105 99.8 Plus
Rab6-RA 1830 CG6601-RA 318..941 17..640 3105 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 19:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12108176..12108799 640..17 3105 99.8 Minus
Blast to na_te.dros performed on 2015-02-09 19:37:39 has no hits.

BO07547.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:21:59 Download gff for BO07547.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab6-PA 1..627 17..641 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:05:35 Download gff for BO07547.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6601-PA 1..627 17..641 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 04:09:36 Download gff for BO07547.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 312..941 10..640 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:20:38 Download gff for BO07547.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 312..941 10..640 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:20:38 Download gff for BO07547.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 12108176..12108805 10..640 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 04:09:36 Download gff for BO07547.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12108176..12108805 10..640 99   Minus

BO07547.complete Sequence

658 bp (658 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630835

> BO07547.complete
GAAGTTATCAGTCGACATGTCATCCGGAGATTTTGGCAATCCGCTGCGGA
AGTTCAAGCTCGTCTTCCTCGGCGAGCAGAGTGTGGGCAAGACCTCGCTG
ATTACGCGCTTCATGTACGACAGCTTCGACAACACGTACCAGGCGACGAT
CGGAATTGATTTCCTATCGAAGACCATGTACCTGGAGGATCGCACTGTGC
GCCTGCAGCTGTGGGATACGGCGGGACAGGAGCGATTCCGCTCGCTGATA
CCCTCGTACATACGCGACTCCACGGTGGCAGTGGTCGTTTACGATATCAC
CAACACCAACTCGTTCCACCAGACCTCCAAGTGGATCGATGACGTGCGCA
CGGAGCGGGGTAGCGACGTCATCATCATGCTGGTGGGCAACAAGACGGAT
CTCTCCGACAAGCGTCAGGTGTCCACCGAGGAGGGTGAGCGCAAGGCGAA
GGAGCTTAACGTGATGTTCATCGAGACAAGCGCCAAGGCCGGCTACAATG
TGAAGCAATTGTTCCGACGGGTGGCCGCGGCACTGCCCGGCATGGATTCC
ACGGAGAACAAGCCCTCCGAGGACATGCAGGAGGTTGTGCTAAAGGACTC
ACCCAACGAGACAAAGGATCCCGAGGGCGGCTGCGCCTGCGCAAGCTTTC
TAGACCAT

BO07547.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-RB 627 CG6601-PB 1..624 17..640 3120 100 Plus
Rab6-RA 627 CG6601-PA 1..624 17..640 3120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-RB 1896 CG6601-RB 318..941 17..640 3120 100 Plus
Rab6-RA 1830 CG6601-RA 318..941 17..640 3120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12108176..12108799 640..17 3120 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:07:24 has no hits.

BO07547.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:19:22 Download gff for BO07547.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 1..627 17..641 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:42:06 Download gff for BO07547.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 320..949 10..640 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:39 Download gff for BO07547.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 318..941 17..642 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:19:22 Download gff for BO07547.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 320..949 10..640 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:11:12 Download gff for BO07547.complete
Subject Subject Range Query Range Percent Splice Strand
Rab6-RA 318..941 17..642 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:11:12 Download gff for BO07547.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12108174..12108799 17..642 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:39 Download gff for BO07547.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12108174..12108799 17..642 99   Minus

BO07547.pep Sequence

Translation from 16 to 658

> BO07547.pep
MSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFL
SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNTNSF
HQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVSTEEGERKAKELNVM
FIETSAKAGYNVKQLFRRVAAALPGMDSTENKPSEDMQEVVLKDSPNETK
DPEGGCACASFLDH

BO07547.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Rab6-PB 208 CG6601-PB 1..208 1..208 1067 100 Plus
Rab6-PA 208 CG6601-PA 1..208 1..208 1067 100 Plus
Rab10-PA 204 CG17060-PA 10..204 13..209 418 42.6 Plus
Rab5-PI 219 CG3664-PI 20..217 3..206 411 40.2 Plus
Rab5-PH 219 CG3664-PH 20..217 3..206 411 40.2 Plus