Clone BO07656 Report

Search the DGRC for BO07656

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:76
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCHKov2-RA
Protein status:BO07656.pep: validated full length
Sequenced Size:1261

Clone Sequence Records

BO07656.3prime Sequence

902 bp (800 high quality bases) assembled on 2006-01-06

> BO07656.3prime
ATGGTCTAGAAAGCTTGCTCTTATGTAACCCCGGTTAATGAGCCATGGCA
ATATGACTTTTATCTGATCCACGTAAGCCGGCAACAGGAACATCTTACGC
TTAAACGCGATCGCCTCCTCCGAATTACCCATTACGTTGCCTATATGTGA
ATCAACATCGGGCGGGAGCAGAACAATTGGAAGCATTCGCTGGGCGCATA
TGAAAGCCCAGAGACTATATCGGTGTAGATGGGCGTGGAACTTGGATAGT
GTGGGTGCATTCCGATTGTAATTGAGCATAGTGAGGTGTTCGACTAGCTG
CTGGTGATAATACTCTATGAAATAGTCGAATTTGTCCAGTTTGATTGAAA
ACTTAGGTGAGGTCATCAGTATGCATAGAAGATCTTGGGCGGGTGTGCCA
TATTTTGGGAGCTGGAAGTCAACAAAGCAAACGTCCTCCACTTCTGAGGC
GTTTTTATACTTGAACATAAAGTTATTGCACCAAAAATCTCCGTGGTTTA
ACACAGATAACTCCAGAGGATCGTTCTTACCAAACTCAATATTCAGATCC
GTCAGTTGAGATGTATAGTCGCTTATGAGAACGAGCTGTCCTGGCTCAAG
ATTATATTGCTGCATGCACTCCAGGAAGGGCATACAAAAATTAATGTTGA
ATTCATCGAGTAATTTCTGGTGCTCAGTAGTAAAGTAACTCTCCCGGATG
TCCTTCTCGTATTCACCCAGCTCGACTACTCTTTTTGCAGAGGCTGCGTG
CCACTGTGCCAACTTCTTGAGGACCGCCTCCACTTCAAACTGCTCCAATC
CCTGGGTTCTGTCGGCATTCCTATATCCCTTTCTCCGCAGATCCTCCAAA
AGAATGTAGTCGCTTTTTACCGGCTCTCCTGNAAACTTCAGATGAACAGG
CT

BO07656.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG10675-PA 1230 CG10675-RA 344..1227 902..19 4351 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 20:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-RA 1450 CG10675-RA 401..1284 902..19 4379 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 20:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25330423..25330751 574..902 1604 99.1 Plus
3R 32079331 3R 25329950..25330142 207..399 965 100 Plus
3R 32079331 3R 25329696..25329884 19..207 945 100 Plus
3R 32079331 3R 25330197..25330372 398..573 880 100 Plus
Blast to na_te.dros performed on 2015-02-04 20:28:15 has no hits.

BO07656.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:25:23 Download gff for BO07656.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10675-PA 344..1230 18..902 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:10:13 Download gff for BO07656.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10675-PA 344..1230 18..902 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:25:49 Download gff for BO07656.3prime
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 401..1284 19..902 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:49:59 Download gff for BO07656.3prime
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 401..1284 19..902 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:49:59 Download gff for BO07656.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 25330423..25330751 574..902 99   Plus
3R 25330198..25330372 399..573 100 <- Plus
3R 25329950..25330141 207..398 100 <- Plus
3R 25329696..25329883 19..206 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:25:49 Download gff for BO07656.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21156145..21156473 574..902 99   Plus
arm_3R 21155920..21156094 399..573 100 <- Plus
arm_3R 21155672..21155863 207..398 100 <- Plus
arm_3R 21155418..21155605 19..206 100 <- Plus

BO07656.5prime Sequence

964 bp (804 high quality bases) assembled on 2006-01-06

> BO07656.5prime
GAAGTTATCAGTCGACATGACTGACCAACCAACTCCACAGTGGGTGACCA
AGGAGCTATTCAGCAGCTTGTTGGAACAGAGTAATCGAAATTTCAAGGCG
ATCATTAAATTTGTTCCAACATCAGCGATTAGCAAAGGGGAAAACTATTT
GACGATCGTGCTGCGCATACAAATTGAAATGCAGCTGAAAGATAACAGCA
TAGAAGATGTCAGCTACATACTGAAGATTCCTTTAGTCCCGGAAGATGAG
AAGAACGACTTCCACGAAATGTTCGATGCCGAACTGGACATGTACGATCA
TCTGATACCAGAATTGGAGGATCTATATGCCAAAAACACTTCCATATCAC
CAAAATTCAAGCCTGTTCATCTGAAGTTTCCAGGAGAGCCGGTAAAAAGC
GACTACATTCTTTTGGAGGATCTGCGGAAGAAGGGATATAGGAATGCCGA
CAGAACCCAGGGATTGGAGCAGTTTGAAGTGGAGGCGGTCCTCAAGAAGT
TGGCACAGTGGCACGCAGCCTCTGCAAAAAGAGTAGTCGAGCTGGGTGAA
TACGAGAAGGACATCCGGGAGAGTTACTTTACTACTGAGCACCAGAAATT
ACTCGATGAATTCAACATTAATTTTTGTATGCCCTTCCTGGAGTGCATGC
AGCAATATAATCTTGAGCCAGGACAGCTCGTTCTCATAAGCGACTATACA
TCTCAACTGACGGATCTGAATATTGAGTTTGGTAAGAACGATCCTCTGGA
GTTATCTGTGTTAAACCACGGAGATTTTTGGTGCAATAACTTTATGTTCA
AGTATAAAAACGCCTCAGAAGTGGAGGACGTTTGCTTTGTTGACTTCCAG
CTCCCAAAATATGGCACACCCGCCCCAGATCTTCTATGCATACTGATGAC
CTCACCTAAGTTTTCAATCAAACTGGACAAATTCGACTATTTCATAGAGT
ATTATCACCAGCAG

BO07656.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG10675-PA 1230 CG10675-RA 1..948 17..964 4715 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 19:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-RA 1450 CG10675-RA 58..1005 17..964 4725 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 19:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25330423..25330921 688..190 2495 100 Minus
3R 32079331 3R 25330197..25330372 864..689 880 100 Minus
3R 32079331 3R 25330968..25331146 195..17 880 99.4 Minus
3R 32079331 3R 25330041..25330142 964..863 495 99 Minus
Blast to na_te.dros performed on 2015-02-09 19:41:13 has no hits.

BO07656.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:25:24 Download gff for BO07656.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10675-PA 1..948 17..964 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:10:14 Download gff for BO07656.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10675-PA 1..948 17..964 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 04:10:10 Download gff for BO07656.5prime
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 51..1005 10..964 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:21:02 Download gff for BO07656.5prime
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 51..1005 10..964 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:21:02 Download gff for BO07656.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 25330972..25331153 10..191 98   Minus
3R 25330423..25330919 192..688 100 <- Minus
3R 25330198..25330372 689..863 100 <- Minus
3R 25330041..25330141 864..964 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 04:10:10 Download gff for BO07656.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21156694..21156875 10..191 98   Minus
arm_3R 21156145..21156641 192..688 100 <- Minus
arm_3R 21155920..21156094 689..863 100 <- Minus
arm_3R 21155763..21155863 864..964 99 <- Minus

BO07656.complete Sequence

1261 bp (1261 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630879

> BO07656.complete
GAAGTTATCAGTCGACATGACTGACCAACCAACTCCACAGTGGGTGACCA
AGGAGCTATTCAGCAGCTTGTTGGAACAGAGTAATCGAAATTTCAAGGCG
ATCATTAAATTTGTTCCAACATCAGCGATTAGCAAAGGGGAAAACTATTT
GACGATCGTGCTGCGCATACAAATTGAAATGCAGCTGAAAGATAACAGCA
TAGAAGATGTCAGCTACATACTGAAGATTCCTTTAGTCCCGGAAGATGAG
AAGAACGACTTCCACGAAATGTTCGATGCCGAACTGGACATGTACGATCA
TCTGATACCAGAATTGGAGGATCTATATGCCAAAAACACTTCCATATCAC
CAAAATTCAAGCCTGTTCATCTGAAGTTTCCAGGAGAGCCGGTAAAAAGC
GACTACATTCTTTTGGAGGATCTGCGGAAGAAGGGATATAGGAATGCCGA
CAGAACCCAGGGATTGGAGCAGTTTGAAGTGGAGGCGGTCCTCAAGAAGT
TGGCACAGTGGCACGCAGCCTCTGCAAAAAGAGTAGTCGAGCTGGGTGAA
TACGAGAAGGACATCCGGGAGAGTTACTTTACTACTGAGCACCAGAAATT
ACTCGATGAATTCAACATTAATTTTTGTATGCCCTTCCTGGAGTGCATGC
AGCAATATAATCTTGAGCCAGGACAGCTCGTTCTCATAAGCGACTATACA
TCTCAACTGACGGATCTGAATATTGAGTTTGGTAAGAACGATCCTCTGGA
GTTATCTGTGTTAAACCACGGAGATTTTTGGTGCAATAACTTTATGTTCA
AGTATAAAAACGCCTCAGAAGTGGAGGACGTTTGCTTTGTTGACTTCCAG
CTCCCAAAATATGGCACACCCGCCCAAGATCTTCTATGCATACTGATGAC
CTCACCTAAGTTTTCAATCAAACTGGACAAATTCGACTATTTCATAGAGT
ATTATCACCAGCAGCTAGTCGAACACCTCACTATGCTCAATTACAATCGG
AATGCACCCACACTATCCAAGTTCCACGCCCATCTACACCGATATAGTCT
CTGGGCTTTCATATGCGCCCAGCGAATGCTTCCAATTGTTCTGCTCCCGC
CCGATGTTGATTCACATATAGGCAACGTAATGGGTAATTCGGAGGAGGCG
ATCGCGTTTAAGCGTAAGATGTTCCTGTTGCCGGCTTACGTGGATCAGAT
AAAAGTCATATTGCCATGGCTCATTAACCGGGGTTACATAAGAGCAAGCT
TTCTAGACCAT

BO07656.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-RA 1230 CG10675-PA 1..1227 17..1243 6135 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-RA 1450 CG10675-RA 58..1284 17..1243 6135 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25330423..25330921 688..190 2495 100 Minus
3R 32079331 3R 25329950..25330142 1055..863 965 100 Minus
3R 32079331 3R 25329696..25329884 1243..1055 945 100 Minus
3R 32079331 3R 25330197..25330372 864..689 880 100 Minus
3R 32079331 3R 25330968..25331146 195..17 880 99.4 Minus
Blast to na_te.dros performed on 2014-11-27 11:00:10 has no hits.

BO07656.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:15:24 Download gff for BO07656.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 1..1230 17..1244 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:37:12 Download gff for BO07656.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 50..1283 10..1243 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:58:20 Download gff for BO07656.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 58..1284 17..1245 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:15:24 Download gff for BO07656.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 50..1283 10..1243 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:36:18 Download gff for BO07656.complete
Subject Subject Range Query Range Percent Splice Strand
CHKov2-RA 58..1284 17..1245 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:36:18 Download gff for BO07656.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25330972..25331146 17..191 100   Minus
3R 25330423..25330919 192..688 100 <- Minus
3R 25330198..25330372 689..863 100 <- Minus
3R 25329950..25330141 864..1055 100 <- Minus
3R 25329694..25329883 1056..1245 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:58:20 Download gff for BO07656.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21156694..21156868 17..191 100   Minus
arm_3R 21156145..21156641 192..688 100 <- Minus
arm_3R 21155920..21156094 689..863 100 <- Minus
arm_3R 21155672..21155863 864..1055 100 <- Minus
arm_3R 21155416..21155605 1056..1245 98 <- Minus

BO07656.pep Sequence

Translation from 16 to 1261

> BO07656.pep
MTDQPTPQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLR
IQIEMQLKDNSIEDVSYILKIPLVPEDEKNDFHEMFDAELDMYDHLIPEL
EDLYAKNTSISPKFKPVHLKFPGEPVKSDYILLEDLRKKGYRNADRTQGL
EQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFTTEHQKLLDEFN
INFCMPFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLELSVLN
HGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFS
IKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFIC
AQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILP
WLINRGYIRASFLDH

BO07656.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
CHKov2-PA 409 CG10675-PA 1..409 1..409 2163 100 Plus
CG10562-PA 405 CG10562-PA 1..401 1..406 726 38.6 Plus
CHKov1-PE 410 CG10618-PE 7..405 7..406 715 36.2 Plus
CG10560-PA 414 CG10560-PA 16..411 5..406 700 36.6 Plus
CG10553-PA 414 CG10553-PA 18..411 7..406 669 35.7 Plus