Clone BO07735 Report

Search the DGRC for BO07735

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:77
Well:35
Vector:pDNR-Dual
Associated Gene/Transcriptshrb-RA
Protein status:BO07735.pep: validated full length
Sequenced Size:712

Clone Sequence Records

BO07735.3prime Sequence

710 bp (709 high quality bases) assembled on 2006-01-06

> BO07735.3prime
ATGGTCTAGAAAGCTTGCGTTGGACCAGGATAAAAGCTGCTTCATGTCTG
GATCATCATCATCCTCCACGGCAGTCGTGGTTGTCGCCTTTTTCTTTTCT
TTGGCCTTCTCGGGCAAATCTTCTGTGGGTGCTTCTGGCAATGTGGGCGT
CGGCTCGGGTATGCCAATGATTTCCTTATCAAAGTTCTCCTGCTCCAGCT
CGTCGAGTTCCCGCTCGAGATCCTCATCATCCAGATCGGCGCCGAATGCC
ACTGGGTTCGAAATGGCATCGGAAATCTCGCGGGCCACGTCCTGCTGCTC
GGCAATGTCATCCATCATGTCGTGCACCTTGTCCACGTCCATATTCTGAT
GGGCTCTCTTGAGGGCATCCGCGGCATTCTTCATCGTGGTCAAGACGGCA
GTGTTTGTGTTGGCGCTCTCCAGAGCCTCGCGCTGCATTTCGATTGTGGA
CAGGGTGCCATCGATCTGCTGGAGTTGCTTCTCCAGCCGCTTCTTTTTCT
TGAGTGCTTGCAGGGCCACTCTTTTGTTTTTAGACGCATTCTTGCGGGCT
ATATTCAGTTCGTCCTCGATCTTGGCCTCCAGGAACTCCTGCTTTTTGAT
AAGCATGTTCTCCGTCTCGCGCAGCTTCTGTATCGCCTCGCCGGTGGTGG
GGGCCACTTCCTTCTTGCCGCCGAACATCTTCCCGAAGAAACTCATGTCG
ACTGATAACT

BO07735.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8055-PA 681 CG8055-RA 1..678 696..19 3390 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-RA 1267 CG8055-RA 118..795 696..19 3390 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9142713..9143000 53..340 1425 99.7 Plus
2R 25286936 2R 9143058..9143238 340..520 905 100 Plus
2R 25286936 2R 9143620..9143797 519..696 890 100 Plus
2R 25286936 2R 9142618..9142656 19..57 195 100 Plus
Blast to na_te.dros performed 2015-02-11 17:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
baggins 5453 baggins BAGGINS 5453bp 1580..1648 249..184 122 66.7 Minus

BO07735.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:27:37 Download gff for BO07735.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8055-PA 1..681 15..696 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:13:31 Download gff for BO07735.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8055-PA 1..681 15..696 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:44:34 Download gff for BO07735.3prime
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 108..798 15..706 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:18:23 Download gff for BO07735.3prime
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 108..798 15..706 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:18:23 Download gff for BO07735.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 9143620..9143807 519..706 97   Plus
2R 9143059..9143236 341..518 100 <- Plus
2R 9142717..9143000 57..340 100 <- Plus
2R 9142614..9142655 15..56 95 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:44:34 Download gff for BO07735.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5031125..5031312 519..706 97   Plus
arm_2R 5030564..5030741 341..518 100 <- Plus
arm_2R 5030222..5030505 57..340 100 <- Plus
arm_2R 5030119..5030160 15..56 95 <- Plus

BO07735.5prime Sequence

710 bp (709 high quality bases) assembled on 2006-01-06

> BO07735.5prime
GAAGTTATCAGTCGACATGAGTTTCTTCGGGAAGATGTTCGGCGGCAAGA
AGGAAGTGGCCCCCACCACCGGCGAGGCGATACAGAAGCTGCGCGAGACG
GAGAACATGCTTATCAAAAAGCAGGAGTTCCTGGAGGCCAAGATCGAGGA
CGAACTGAATATAGCCCGCAAGAATGCGTCTAAAAACAAAAGAGTGGCCC
TGCAAGCACTCAAGAAAAAGAAGCGGCTGGAGAAGCAACTCCAGCAGATC
GATGGCACCCTGTCCACAATCGAAATGCAGCGCGAGGCTCTGGAGAGCGC
CAACACAAACACTGCCGTCTTGACCACGATGAAGAATGCCGCGGATGCCC
TCAAGAGAGCCCATCAGAATATGGACGTGGACAAGGTGCACGACATGATG
GATGACATTGCCGAGCAGCAGGACGTGGCCCGCGAGATTTCCGATGCCAT
TTCGAACCCAGTGGCATTCGGCGCCGATCTGGATGATGAGGATCTCGAGC
GGGAACTCGACGAGCTGGAGCAGGAGAACTTTGATAAGGAAATCATTGGC
ATACCCGAGCCGACGCCCACATTGCCAGAAGCACCCACAGAAGATTTGCC
CGAGAAGGCCAAAGAAAAGAAAAAGGCGACAACCACGACTGCCGTGGAGG
ATGATGATGATCCAGACATGAAGCAGCTTTTATCCTGGTCCAACGCAAGC
TTTCTAGACC

BO07735.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG8055-PA 681 CG8055-RA 1..678 17..694 3390 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-RA 1267 CG8055-RA 118..795 17..694 3390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9142713..9143000 660..373 1425 99.7 Minus
2R 25286936 2R 9143058..9143238 373..193 905 100 Minus
2R 25286936 2R 9143620..9143797 194..17 890 100 Minus
2R 25286936 2R 9142618..9142656 694..656 195 100 Minus
Blast to na_te.dros performed 2015-02-13 01:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
baggins 5453 baggins BAGGINS 5453bp 1580..1648 464..529 122 66.7 Plus

BO07735.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:27:38 Download gff for BO07735.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8055-PA 1..681 17..698 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:13:32 Download gff for BO07735.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8055-PA 1..681 17..698 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:33:31 Download gff for BO07735.5prime
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 108..798 7..698 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:26:14 Download gff for BO07735.5prime
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 108..798 7..698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:26:14 Download gff for BO07735.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 9143620..9143807 7..194 97   Minus
2R 9143059..9143236 195..372 100 <- Minus
2R 9142717..9143000 373..656 100 <- Minus
2R 9142614..9142655 657..698 95 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:33:31 Download gff for BO07735.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5031125..5031312 7..194 97   Minus
arm_2R 5030564..5030741 195..372 100 <- Minus
arm_2R 5030222..5030505 373..656 100 <- Minus
arm_2R 5030119..5030160 657..698 95 <- Minus

BO07735.complete Sequence

712 bp (712 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630911

> BO07735.complete
GAAGTTATCAGTCGACATGAGTTTCTTCGGGAAGATGTTCGGCGGCAAGA
AGGAAGTGGCCCCCACCACCGGCGAGGCGATACAGAAGCTGCGCGAGACG
GAGAACATGCTTATCAAAAAGCAGGAGTTCCTGGAGGCCAAGATCGAGGA
CGAACTGAATATAGCCCGCAAGAATGCGTCTAAAAACAAAAGAGTGGCCC
TGCAAGCACTCAAGAAAAAGAAGCGGCTGGAGAAGCAACTCCAGCAGATC
GATGGCACCCTGTCCACAATCGAAATGCAGCGCGAGGCTCTGGAGAGCGC
CAACACAAACACTGCCGTCTTGACCACGATGAAGAATGCCGCGGATGCCC
TCAAGAGAGCCCATCAGAATATGGACGTGGACAAGGTGCACGACATGATG
GATGACATTGCCGAGCAGCAGGACGTGGCCCGCGAGATTTCCGATGCCAT
TTCGAACCCAGTGGCATTCGGCGCCGATCTGGATGATGAGGATCTCGAGC
GGGAACTCGACGAGCTGGAGCAGGAGAACTTTGATAAGGAAATCATTGGC
ATACCCGAGCCGACGCCCACATTGCCAGAAGCACCCACAGAAGATTTGCC
CGAGAAGGCCAAAGAAAAGAAAAAGGCGACAACCACGACTGCCGTGGAGG
ATGATGATGATCCAGACATGAAGCAGCTTTTATCCTGGTCCAACGCAAGC
TTTCTAGACCAT

BO07735.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-RA 681 CG8055-PA 1..678 17..694 3390 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-RA 1267 CG8055-RA 118..795 17..694 3390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9142713..9143000 660..373 1425 99.7 Minus
2R 25286936 2R 9143058..9143238 373..193 905 100 Minus
2R 25286936 2R 9143620..9143797 194..17 890 100 Minus
2R 25286936 2R 9142618..9142656 694..656 195 100 Minus
Blast to na_te.dros performed 2014-11-27 13:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
baggins 5453 baggins BAGGINS 5453bp 1580..1648 464..529 122 66.7 Plus

BO07735.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:15:01 Download gff for BO07735.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 1..681 17..698 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:36:42 Download gff for BO07735.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 104..794 7..698 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:11 Download gff for BO07735.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 118..795 17..696 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:15:01 Download gff for BO07735.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 104..794 7..698 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:22:09 Download gff for BO07735.complete
Subject Subject Range Query Range Percent Splice Strand
shrb-RA 118..795 17..696 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:22:09 Download gff for BO07735.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9143620..9143797 17..194 100   Minus
2R 9143059..9143236 195..372 100 <- Minus
2R 9142717..9143000 373..656 100 <- Minus
2R 9142616..9142655 657..696 95 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:11 Download gff for BO07735.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5031125..5031302 17..194 100   Minus
arm_2R 5030564..5030741 195..372 100 <- Minus
arm_2R 5030222..5030505 373..656 100 <- Minus
arm_2R 5030121..5030160 657..696 95 <- Minus

BO07735.pep Sequence

Translation from 16 to 712

> BO07735.pep
MSFFGKMFGGKKEVAPTTGEAIQKLRETENMLIKKQEFLEAKIEDELNIA
RKNASKNKRVALQALKKKKRLEKQLQQIDGTLSTIEMQREALESANTNTA
VLTTMKNAADALKRAHQNMDVDKVHDMMDDIAEQQDVAREISDAISNPVA
FGADLDDEDLERELDELEQENFDKEIIGIPEPTPTLPEAPTEDLPEKAKE
KKKATTTTAVEDDDDPDMKQLLSWSNASFLDH

BO07735.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
shrb-PA 226 CG8055-PA 1..226 1..226 1135 100 Plus
Vps20-PC 212 CG4071-PC 2..211 5..211 202 31.8 Plus
Vps20-PA 212 CG4071-PA 2..211 5..211 202 31.8 Plus
Vps60-PB 226 CG6259-PB 5..196 4..193 191 26.7 Plus
Vps60-PA 226 CG6259-PA 5..196 4..193 191 26.7 Plus