Clone BO07737 Report

Search the DGRC for BO07737

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:77
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG8974-RA
Protein status:BO07737.pep: validated full length
Sequenced Size:865

Clone Sequence Records

BO07737.3prime Sequence

863 bp (785 high quality bases) assembled on 2006-01-06

> BO07737.3prime
ATGGTCTAGAAAGCTTGCTGCATAGAACAGCCACAATATCCACACAACGG
CCAAATACGAAAACAGCTTGGACAGGGTCTGTTCATCCTCGTATTGCCTT
GTTCCCCGATTAGCAGCAGGTGGACGTGGTTCGCCAAAGTTGAGCGTAGA
TGTTATGAACCCGAAAGGAAAAGCTCCAATACCGAAAGACATGTGAAATC
CGTCGCCGAATCCGAATCCAGGGAACCCGGGAACAGGATCTGGTTCTGTA
CGTTGTCCAGCGGGGCGTGGTGGAACTTTGTTACGTGGATCTTCCTGGTG
TGTACTATTTCTTCCGTACAGCGGTATGACCTTATCCTTATCAACGGCAG
CCTTACAAACGGGACAGAGTTTGCGATTGGGACGCGTCAGGAGCCACTGA
TGCAGGCACGGCCAGCAGAACAGATGGCCGCACATGCTGACCACAGCATC
CTTGGCGGTGTCCAGGCATATGTTGCACTCGTAGAGTGAGTCGTCTGCGG
TATGTTCCTTCTCCTTGTCCTTTTCGTTGGCTTTTGTGTCCGTATCGGTG
CCGCCGAATGGATAGCCACCCTTCAGATCGGCCTTATTGCCACCAGATAG
ATAGTCTCCAGTAAAGGAATACGAAGTGTTGGACTTCTTCAGTTCCGATG
CCGTCGAATTGGTTGGAATCGAGGTACCCAGCGGGCGCAATTGACTTGTA
GATGACTCCTCAGCCAAGGGTTCTGTGATATCCCGAGTCCAGGCTATCTT
GTCGTAGCTCACGTTGTTGGACAAAGTCGATGAGGACGACGATGCCCCGG
TTGATGTGCTGGGAAGCTCCGCTGTGGGTCACTTTTTCGGTTCCTCCATG
TCGACTGATAACT

BO07737.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-PC 834 CG8974-RC 21..831 829..19 4055 100 Minus
CG8974-PA 834 CG8974-RA 21..831 829..19 4055 100 Minus
CG8974-PB 834 CG8974-RB 21..831 829..19 4055 100 Minus
CG8974-PD 834 CG8974-RD 21..831 829..19 4055 100 Minus
CG8974-PE 834 CG8974-RE 21..831 829..19 4055 100 Minus
CG32581-PA 675 CG32581-RA 23..544 827..306 2610 100 Minus
CG32581-PA 675 CG32581-RA 545..675 283..153 655 100 Minus
CG32847-PB 495 CG32847-RB 44..119 485..410 155 88.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-RE 1317 CG8974-RE 103..934 850..19 4115 99.8 Minus
CG8974-RD 1280 CG8974-RD 66..897 850..19 4115 99.8 Minus
CG8974-RB 1389 CG8974-RB 175..1006 850..19 4115 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15794497..15795063 284..850 2775 99.3 Plus
X 23542271 X 15797667..15798233 284..850 2760 99.1 Plus
X 23542271 X 15794267..15794434 117..284 840 100 Plus
X 23542271 X 15797437..15797604 117..284 795 98.2 Plus
X 23542271 X 15794104..15794202 19..117 495 100 Plus
3L 28110227 3L 15121665..15121843 485..307 310 78.2 Minus
Blast to na_te.dros performed on 2015-02-11 02:56:57 has no hits.

BO07737.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:27:41 Download gff for BO07737.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-PD 1..834 18..849 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:13:36 Download gff for BO07737.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-PA 1..834 18..849 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:23:12 Download gff for BO07737.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 170..1015 8..857 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 05:23:29 Download gff for BO07737.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 170..1015 8..857 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 05:23:29 Download gff for BO07737.3prime
Subject Subject Range Query Range Percent Splice Strand
X 15794497..15795068 284..857 98   Plus
X 15794267..15794433 117..283 100 <- Plus
X 15794095..15794201 8..116 95 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:23:12 Download gff for BO07737.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15688530..15689101 284..857 98   Plus
arm_X 15688300..15688466 117..283 100 <- Plus
arm_X 15688128..15688234 8..116 95 <- Plus

BO07737.5prime Sequence

863 bp (830 high quality bases) assembled on 2006-01-06

> BO07737.5prime
GAAGTTATCAGTCGACATGGAGGAACCGAAAAGTGTACCCACAGCGGAGC
TTCCCAGCACATCAACCGGGGCATCGTCGTCCTCATCGACTTTGTCCAAC
AACGTGAGCTACGACAAGATAGCCTGGACTCGGGATATCACAGAACCCTT
GGCTGAGGAGTCATCTACAAGTCAATTGCGCCCGCTGGGTACCTCGATTC
CAACCAATTCGACGGCATCGGAACTGAAGAAGTCCAACACTTCGTATTCC
TTTACTGGAGACTATCTATCTGGTGGCAATAAGGCCGATCTGAAGGGTGG
CTATCCATTCGGCGGCACCGATACGGACACAAAAGCCAACGAAAAGGACA
AGGAGAAGGAACATACCGCAGACGACTCACTCTACGAGTGCAACATATGC
CTGGACACCGCCAAGGATGCTGTGGTCAGCATGTGCGGCCATCTGTTCTG
CTGGCCGTGCCTGCATCAGTGGCTCCTGACGCGTCCCAATCGCAAACTCT
GTCCCGTTTGTAAGGCTGCCGTTGATAAGGATAAGGTCATACCGCTGTAC
GGAAGAAATAGTACACACCAGGAAGATCCACGTAACAAAGTTCCACCACG
CCCCGCTGGACAACGTACAGAACCAGATCCTGTTCCCGGGTTCCCTGGAT
TCGGATTCGGCGACGGATTTCACATGTCTTTCGGTATTGGAGCTTTTCCT
TTCGGGTTCATAACATCTACGCTCAACTTTGGCGAACCACGTCCACCTGC
TGCTAATCGGGGAACAAGGCAATACGAGGATGAACAGACCCTGTCCAAGC
TGTTTTCGTATTTGGCCGTTGTGTGGATATTGTGGCTGTTCTATGCAGCA
AGCTTTCTAGACC

BO07737.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-PC 834 CG8974-RC 1..831 17..847 4155 100 Plus
CG8974-PA 834 CG8974-RA 1..831 17..847 4155 100 Plus
CG8974-PB 834 CG8974-RB 1..831 17..847 4155 100 Plus
CG8974-PD 834 CG8974-RD 1..831 17..847 4155 100 Plus
CG8974-PE 834 CG8974-RE 1..831 17..847 4155 100 Plus
CG32581-PA 675 CG32581-RA 1..544 17..560 2695 99.8 Plus
CG32581-PA 675 CG32581-RA 545..675 583..713 655 100 Plus
CG32847-PB 495 CG32847-RB 44..119 381..456 155 88.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-RE 1317 CG8974-RE 103..934 16..847 4160 100 Plus
CG8974-RD 1280 CG8974-RD 66..897 16..847 4160 100 Plus
CG8974-RB 1389 CG8974-RB 175..1006 16..847 4160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15794497..15795063 582..16 2835 100 Minus
X 23542271 X 15797667..15798233 582..16 2820 99.8 Minus
X 23542271 X 15794267..15794434 749..582 840 100 Minus
X 23542271 X 15797437..15797604 749..582 795 98.2 Minus
X 23542271 X 15794104..15794202 847..749 495 100 Minus
3L 28110227 3L 15121665..15121843 381..559 310 78.2 Plus
Blast to na_te.dros performed on 2015-02-13 16:27:47 has no hits.

BO07737.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:27:42 Download gff for BO07737.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-PD 1..834 17..848 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:13:38 Download gff for BO07737.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-PA 1..834 17..848 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:12:27 Download gff for BO07737.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 170..1015 9..858 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 19:03:25 Download gff for BO07737.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 170..1015 9..858 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 19:03:25 Download gff for BO07737.5prime
Subject Subject Range Query Range Percent Splice Strand
X 15794497..15795068 9..582 99   Minus
X 15794267..15794433 583..749 100 <- Minus
X 15794095..15794201 750..858 95 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:12:27 Download gff for BO07737.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15688530..15689101 9..582 99   Minus
arm_X 15688300..15688466 583..749 100 <- Minus
arm_X 15688128..15688234 750..858 95 <- Minus

BO07737.complete Sequence

865 bp (865 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630913

> BO07737.complete
GAAGTTATCAGTCGACATGGAGGAACCGAAAAGTGTACCCACAGCGGAGC
TTCCCAGCACATCAACCGGGGCATCGTCGTCCTCATCGACTTTGTCCAAC
AACGTGAGCTACGACAAGATAGCCTGGACTCGGGATATCACAGAACCCTT
GGCTGAGGAGTCATCTACAAGTCAATTGCGCCCGCTGGGTACCTCGATTC
CAACCAATTCGACGGCATCGGAACTGAAGAAGTCCAACACTTCGTATTCC
TTTACTGGAGACTATCTATCTGGTGGCAATAAGGCCGATCTGAAGGGTGG
CTATCCATTCGGCGGCACCGATACGGACACAAAAGCCAACGAAAAGGACA
AGGAGAAGGAACATACCGCAGACGACTCACTCTACGAGTGCAACATATGC
CTGGACACCGCCAAGGATGCTGTGGTCAGCATGTGCGGCCATCTGTTCTG
CTGGCCGTGCCTGCATCAGTGGCTCCTGACGCGTCCCAATCGCAAACTCT
GTCCCGTTTGTAAGGCTGCCGTTGATAAGGATAAGGTCATACCGCTGTAC
GGAAGAAATAGTACACACCAGGAAGATCCACGTAACAAAGTTCCACCACG
CCCCGCTGGACAACGTACAGAACCAGATCCTGTTCCCGGGTTCCCTGGAT
TCGGATTCGGCGACGGATTTCACATGTCTTTCGGTATTGGAGCTTTTCCT
TTCGGGTTCATAACATCTACGCTCAACTTTGGCGAACCACGTCCACCTGC
TGCTAATCGGGGAACAAGGCAATACGAGGATGAACAGACCCTGTCCAAGC
TGTTTTCGTATTTGGCCGTTGTGTGGATATTGTGGCTGTTCTATGCAGCA
AGCTTTCTAGACCAT

BO07737.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-RE 834 CG8974-PE 1..831 17..847 4155 100 Plus
CG8974-RD 834 CG8974-PD 1..831 17..847 4155 100 Plus
CG8974-RB 834 CG8974-PB 1..831 17..847 4155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-RE 1317 CG8974-RE 103..934 16..847 4160 100 Plus
CG8974-RD 1280 CG8974-RD 66..897 16..847 4160 100 Plus
CG8974-RB 1389 CG8974-RB 175..1006 16..847 4160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15794497..15795063 582..16 2835 100 Minus
X 23542271 X 15797667..15798233 582..16 2820 99.8 Minus
X 23542271 X 15794267..15794434 749..582 840 100 Minus
X 23542271 X 15797437..15797604 749..582 795 98.2 Minus
X 23542271 X 15794104..15794202 847..749 495 100 Minus
3L 28110227 3L 15121665..15121843 381..559 310 78.2 Plus
Blast to na_te.dros performed on 2014-11-26 22:18:54 has no hits.

BO07737.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:10:04 Download gff for BO07737.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 1..834 17..848 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:27:29 Download gff for BO07737.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 195..1040 9..858 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:54:02 Download gff for BO07737.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 176..1006 17..849 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:10:04 Download gff for BO07737.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 195..1040 9..858 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:57:23 Download gff for BO07737.complete
Subject Subject Range Query Range Percent Splice Strand
CG8974-RB 176..1006 17..849 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:57:23 Download gff for BO07737.complete
Subject Subject Range Query Range Percent Splice Strand
X 15794497..15795062 17..582 100   Minus
X 15794267..15794433 583..749 100 <- Minus
X 15794100..15794201 750..849 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:54:02 Download gff for BO07737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15688530..15689095 17..582 100   Minus
arm_X 15688300..15688466 583..749 100 <- Minus
arm_X 15688133..15688234 750..849 98 <- Minus

BO07737.pep Sequence

Translation from 16 to 865

> BO07737.pep
MEEPKSVPTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESS
TSQLRPLGTSIPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGG
TDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLH
QWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQR
TEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSTLNFGEPRPPAANRGT
RQYEDEQTLSKLFSYLAVVWILWLFYAASFLDH

BO07737.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8974-PE 277 CG8974-PE 1..277 1..277 1501 100 Plus
CG8974-PD 277 CG8974-PD 1..277 1..277 1501 100 Plus
CG8974-PB 277 CG8974-PB 1..277 1..277 1501 100 Plus
CG8974-PA 277 CG8974-PA 1..277 1..277 1501 100 Plus
CG8974-PC 277 CG8974-PC 1..277 1..277 1501 100 Plus