Clone BO07812 Report

Search the DGRC for BO07812

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:78
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptDlic-RA
Protein status:BO07812.pep: validated full length
Sequenced Size:1513

Clone Sequence Records

BO07812.3prime Sequence

932 bp (843 high quality bases) assembled on 2006-01-06

> BO07812.3prime
ATGGTCTAGAAAGCTTGCACACTCACTCTGCGACATGTCAATCTCTTTTT
TCACACTGCGCGATAATCGATCAAGCTCGGCGGCCGCATCTGTGCGCACG
GCCAGCTTTTCGGGCGTCATTACTGCATCCGTACCGTTGGCAGTGCGACC
CGGACCCGCCGGATTACCCGCTCCGCCGGGACCTCCGGTACCCGGACTGC
CCGACTTTTTGTGCAGCAGCGAGTTAAAGAAGTTGGCTAGAACGCCTTCG
GCGCCGGGCGTTGCTGGCGTCAGCTTGGGATCAATCTTTTTGGGCGAACT
CTGTCCGGTGGTGCCGGGCGTTCGGGGTCCGCTCTTATTGCTGCCTACGC
CCTGCGATCGCAGTGGTGACTCACCGCGCACCTGGTCGCCCTGCTTTAGG
ATCTCCTGCTGGCGTGCCAGGAATGCCTGCTCATCCTCCGTCTGCACTTC
CGCCTCGCGATTGGAAACCGCCTTTCTAGTTGGTGGCGATTTGATAATGT
CTGTGTAGGGATTCTCGGCCTTGACTCCATGCATATTCTCGTATAAAATA
CTAATCTTCTTCAGGCTATCCCAGCCAGCCGGAATGAGTACCGCATCCTT
CTCAACGACTAGCGCTGGCGTACGGAATGGTAGACCATAAATTCGATGCG
TCAGATACTTGTAGAGGACATCACAGTTCTTGTCTTCCTTGACGCTCGTG
TAGAAGAGCGAAGTGCCATGCCGCAGGCAGAAGTTACGTATCCACTGCTG
GATGAAGTCAAAGTGCTCGTCACGATACTCGTACTCCTTCTCTAGCGTGG
TCATGTAGTCCGTCTTTGTGACCACAACAACGATGTCGAGGCCCAGATTT
GTAATTAGTGCATCCTCCGTCAGCGGCAGCAGGTCATCCTCGTCGATCGA
GTTGTTGCGCATCGTCCGCTTGACGGGGGAGC

BO07812.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG1938-PD 1482 Dlic2-RD 566..1479 932..19 4570 100 Minus
CG1938-PB 1197 Dlic2-RB 281..1194 932..19 4570 100 Minus
CG1938-PA 1482 Dlic2-RA 566..1479 932..19 4570 100 Minus
CG1938-PC 1482 Dlic2-RC 566..1479 932..19 4570 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-RA 2241 CG1938-RA 914..1827 932..19 4570 100 Minus
Dlic-RB 3371 CG1938-RB 570..1483 932..19 4570 100 Minus
Dlic-RD 3715 CG1938-RD 914..1827 932..19 4570 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11162514..11162782 287..19 1345 100 Minus
X 23542271 X 11161781..11162012 815..584 1160 100 Minus
X 23542271 X 11162267..11162454 473..286 940 100 Minus
X 23542271 X 11161600..11161718 932..814 595 100 Minus
X 23542271 X 11162086..11162198 583..471 565 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:19:43 has no hits.

BO07812.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:29:47 Download gff for BO07812.3prime
Subject Subject Range Query Range Percent Splice Strand
Dlic2-PC 566..1482 16..932 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:16:39 Download gff for BO07812.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1938-PC 566..1482 16..932 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:49:15 Download gff for BO07812.3prime
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 914..1832 13..932 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:59:08 Download gff for BO07812.3prime
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 914..1832 13..932 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:59:08 Download gff for BO07812.3prime
Subject Subject Range Query Range Percent Splice Strand
X 11162516..11162787 13..285 98   Minus
X 11162269..11162454 286..471 100 -> Minus
X 11162086..11162197 472..583 100 -> Minus
X 11161783..11162012 584..813 100 -> Minus
X 11161600..11161718 814..932 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:49:15 Download gff for BO07812.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11056549..11056820 13..285 98   Minus
arm_X 11056302..11056487 286..471 100 -> Minus
arm_X 11056119..11056230 472..583 100 -> Minus
arm_X 11055816..11056045 584..813 100 -> Minus
arm_X 11055633..11055751 814..932 100 -> Minus

BO07812.5prime Sequence

885 bp (827 high quality bases) assembled on 2006-01-06

> BO07812.5prime
GAAGTTATCAGTCGACATGGCGATGAACAGTGGGACGCAAACGAATGCGC
TGACATCATCCTTTACCATGAAGAAAAAGGATGCGGCCGCGGAAAAGGAG
AACCTATGGTCGGCGATATTGAATGAAGTACAAACACAGGGCAGCACAAA
ACTTCCATCAAACAAATCTGTACTAGTATTAGGCGACAATGCCACCGGAA
AGACGACACTCATTGCCAAACTGCAGGGCGTCGAGGATCCGAAGAAGGGT
TCCGGCCTGGAGTATGCCTACATTGATGTCAAGGATGAGTACAGAGACGA
CATGACGCGTTTAGGCGTTTGGGTCCTGGACGGTGATCCAGGACACACAA
ACCTGCTACACTATGCGCTCAACGAAACGAACTATGCACACACACTCGTC
ATCCTCACCGTTTCGATGACGCAGCCGTGGGGCTGGCTGGAGCAGCTAAA
CCATTGGATCAAGGTCCTCGGCCAGCACATCGATAGCCTGCAGCTGGACG
CCAAAGAGAAGGAGGCGGCCCGCCAGCGACTGACCACCACGTGGCAGAGC
TACTGTGAGGTGGGCGACGATCTGGATCCAGGCTCCCCCGTCAAGCGGAC
GATGCGCAACAACTCGATCGACGAGGATGACCTGCTGCCGCTGACGGAGG
ATGCACTAATTACAAATCTGGGCCTCGACATCGTTGTTGTGGTCACAAAG
ACGGACTACATGACCACGCTAGAGAAGGAGTACGAGTATCGTGACGAGCA
CTTTGACTTCATCCAGCAGTGGATACGTAACTTCTGCCTGCGGCATGGCA
CTTCGCTCTTCTACACGAGCGTCAAGGAAGACAAGAACTGTGATGTCCTC
TACAAGTATCTGACGCATCGAATTTATGGTCTACC

BO07812.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG1938-PD 1482 Dlic2-RD 1..869 17..885 4345 100 Plus
CG1938-PA 1482 Dlic2-RA 1..869 17..885 4345 100 Plus
CG1938-PC 1482 Dlic2-RC 1..869 17..885 4345 100 Plus
CG1938-PB 1197 Dlic2-RB 1..584 302..885 2920 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-RA 2241 CG1938-RA 347..1217 15..885 4355 100 Plus
Dlic-RD 3715 CG1938-RD 347..1217 15..885 4355 100 Plus
Dlic-RB 3371 CG1938-RB 97..873 109..885 3885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11161317..11161718 299..700 2010 100 Plus
X 23542271 X 11161060..11161251 108..299 960 100 Plus
X 23542271 X 11161781..11161967 699..885 935 100 Plus
X 23542271 X 11155135..11155230 15..110 480 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:40:21 has no hits.

BO07812.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:29:48 Download gff for BO07812.5prime
Subject Subject Range Query Range Percent Splice Strand
Dlic2-PC 1..869 17..885 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:16:40 Download gff for BO07812.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1938-PC 1..869 17..885 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:09:01 Download gff for BO07812.5prime
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 342..1217 9..885 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:19:56 Download gff for BO07812.5prime
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 342..1217 9..885 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:19:56 Download gff for BO07812.5prime
Subject Subject Range Query Range Percent Splice Strand
X 11161783..11161967 701..885 100   Plus
X 11161318..11161718 300..700 100 -> Plus
X 11161061..11161251 109..299 100 -> Plus
X 11155130..11155228 9..108 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:09:01 Download gff for BO07812.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11055816..11056000 701..885 100   Plus
arm_X 11055351..11055751 300..700 100 -> Plus
arm_X 11055094..11055284 109..299 100 -> Plus
arm_X 11049163..11049261 9..108 97 -> Plus

BO07812.complete Sequence

1513 bp (1513 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ630941

> BO07812.complete
GAAGTTATCAGTCGACATGGCGATGAACAGTGGGACGCAAACGAATGCGC
TGACATCATCCTTTACCATGAAGAAAAAGGATGCGGCCGCGGAAAAGGAG
AACCTATGGTCGGCGATATTGAATGAAGTACAAACACAGGGCAGCACAAA
ACTTCCATCAAACAAATCTGTACTAGTATTAGGCGACAATGCCACCGGAA
AGACGACACTCATTGCCAAACTGCAGGGCGTCGAGGATCCGAAGAAGGGT
TCCGGCCTGGAGTATGCCTACATTGATGTCAAGGATGAGTACAGAGACGA
CATGACGCGTTTAGGCGTTTGGGTCCTGGACGGTGATCCAGGACACACAA
ACCTGCTACACTATGCGCTCAACGAAACGAACTATGCACACACACTCGTC
ATCCTCACCGTTTCGATGACGCAGCCGTGGGGCTGGCTGGAGCAGCTAAA
CCATTGGATCAAGGTCCTCGGCCAGCACATCGATAGCCTGCAGCTGGACG
CCAAAGAGAAGGAGGCGGCCCGCCAGCGACTGACCACCACGTGGCAGAGC
TACTGTGAGGTGGGCGACGATCTGGATCCAGGCTCCCCCGTCAAGCGGAC
GATGCGCAACAACTCGATCGACGAGGATGACCTGCTGCCGCTGACGGAGG
ATGCACTAATTACAAATCTGGGCCTCGACATCGTTGTTGTGGTCACAAAG
ACGGACTACATGACCACGCTAGAGAAGGAGTACGAGTATCGTGACGAGCA
CTTTGACTTCATCCAGCAGTGGATACGTAACTTCTGCCTGCGGCATGGCA
CTTCGCTCTTCTACACGAGCGTCAAGGAAGACAAGAACTGTGATGTCCTC
TACAAGTATCTGACGCATCGAATTTATGGTCTACCATTCCGTACGCCAGC
GCTAGTCGTTGAGAAGGATGCGGTACTCATTCCGGCTGGCTGGGATAGCC
TGAAGAAGATTAGTATTTTATACGAGAATATGCATGGAGTCAAGGCCGAG
AATCCCTACACAGACATTATCAAATCGCCACCAACTAGAAAGGCGGTTTC
CAATCGCGAGGCGGAAGTGCAGACGGAGGATGAGCAGGCATTCCTGGCAC
GCCAGCAGGAGATCCTAAAGCAGGGCGACCAGGTGCGCGGTGAGTCACCA
CTGCGATCGCAGGGCGTAGGCAGCAATAAGAGCGGACCCCGAACGCCCGG
CACCACCGGACAGAGTTCGCCCAAAAAGATTGATCCCAAGCTGACGCCAG
CAACGCCCGGCGCCGAAGGCGTTCTAGCCAACTTCTTTAACTCGCTGCTG
CACAAAAAGTCGGGCAGTCCGGGTACCGGAGGTCCCGGCGGAGCGGGTAA
TCCGGCGGGTCCGGGTCGCACTGCCAACGGTACGGATGCAGTAATGACGC
CCGAAAAGCTGGCCGTGCGCACAGATGCGGCCGCCGAGCTTGATCGATTA
TCGCGCAGTGTGAAAAAAGAGATTGACATGTCGCAGAGTGAGTGTGCAAG
CTTTCTAGACCAT

BO07812.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-RA 1482 CG1938-PA 1..1479 17..1495 7395 100 Plus
Dlic-RD 1482 CG1938-PD 1..1479 17..1495 7395 100 Plus
Dlic-RB 1197 CG1938-PB 1..1194 302..1495 5970 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-RA 2241 CG1938-RA 347..1827 15..1495 7405 100 Plus
Dlic-RD 3715 CG1938-RD 347..1827 15..1495 7405 100 Plus
Dlic-RB 3371 CG1938-RB 97..1483 109..1495 6935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11161317..11161718 299..700 2010 100 Plus
X 23542271 X 11162514..11162782 1227..1495 1345 100 Plus
X 23542271 X 11161781..11162012 699..930 1160 100 Plus
X 23542271 X 11161060..11161251 108..299 960 100 Plus
X 23542271 X 11162267..11162454 1041..1228 940 100 Plus
X 23542271 X 11162086..11162198 931..1043 565 100 Plus
X 23542271 X 11155135..11155230 15..110 480 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:56:56 has no hits.

BO07812.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:14:38 Download gff for BO07812.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic2-RC 1..1482 17..1498 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:36:13 Download gff for BO07812.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic2-RC 387..1877 9..1501 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:34:55 Download gff for BO07812.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 349..1827 17..1497 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:14:38 Download gff for BO07812.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic2-RC 387..1877 9..1501 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:41:00 Download gff for BO07812.complete
Subject Subject Range Query Range Percent Splice Strand
Dlic-RD 349..1827 17..1497 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:41:00 Download gff for BO07812.complete
Subject Subject Range Query Range Percent Splice Strand
X 11162516..11162782 1229..1497 99   Plus
X 11162269..11162454 1043..1228 100 -> Plus
X 11162086..11162197 931..1042 100 -> Plus
X 11161783..11162012 701..930 100 -> Plus
X 11161318..11161718 300..700 100 -> Plus
X 11161061..11161251 109..299 100 -> Plus
X 11155137..11155228 17..108 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:34:55 Download gff for BO07812.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11056549..11056815 1229..1497 99   Plus
arm_X 11056302..11056487 1043..1228 100 -> Plus
arm_X 11056119..11056230 931..1042 100 -> Plus
arm_X 11055816..11056045 701..930 100 -> Plus
arm_X 11055351..11055751 300..700 100 -> Plus
arm_X 11055094..11055284 109..299 100 -> Plus
arm_X 11049170..11049261 17..108 100 -> Plus

BO07812.pep Sequence

Translation from 16 to 1513

> BO07812.pep
MAMNSGTQTNALTSSFTMKKKDAAAEKENLWSAILNEVQTQGSTKLPSNK
SVLVLGDNATGKTTLIAKLQGVEDPKKGSGLEYAYIDVKDEYRDDMTRLG
VWVLDGDPGHTNLLHYALNETNYAHTLVILTVSMTQPWGWLEQLNHWIKV
LGQHIDSLQLDAKEKEAARQRLTTTWQSYCEVGDDLDPGSPVKRTMRNNS
IDEDDLLPLTEDALITNLGLDIVVVVTKTDYMTTLEKEYEYRDEHFDFIQ
QWIRNFCLRHGTSLFYTSVKEDKNCDVLYKYLTHRIYGLPFRTPALVVEK
DAVLIPAGWDSLKKISILYENMHGVKAENPYTDIIKSPPTRKAVSNREAE
VQTEDEQAFLARQQEILKQGDQVRGESPLRSQGVGSNKSGPRTPGTTGQS
SPKKIDPKLTPATPGAEGVLANFFNSLLHKKSGSPGTGGPGGAGNPAGPG
RTANGTDAVMTPEKLAVRTDAAAELDRLSRSVKKEIDMSQSECASFLDH

BO07812.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dlic-PA 493 CG1938-PA 1..493 1..493 2578 100 Plus
Dlic-PD 493 CG1938-PD 1..493 1..493 2578 100 Plus
Dlic-PB 398 CG1938-PB 1..398 96..493 2100 100 Plus