Clone BO08052 Report

Search the DGRC for BO08052

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:80
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG11200-RA
Protein status:BO08052.pep: validated full length
Sequenced Size:1099

Clone Sequence Records

BO08052.3prime Sequence

899 bp (864 high quality bases) assembled on 2006-01-06

> BO08052.3prime
ATGGTCTAGAAAGCTTGCGTATTCGCCATTTCCGTACTGCTGGATTTTCA
ACAGGTCGCAGGAGAACTGGAAAAGCTGCTCGCACTTTGCCGGCTTCTTG
GCATCCGGATGGAAAGGACCCTTTCCGCCGTTGGAGAGGTAAGTACCACC
CTGACCCTCGATGGAGGGATCAATGGCCGCGAAGACCACCGTGCGGGATC
CCCTTTCCGGAGTCTTGAAGAATAGCTTCTTGAAAATGGGCACCGATGTG
GTGGCCGAGTGCTCGAACAGATCCGTGTCCACAATGCCCGGATGCACCAC
ATTGACCTGCACGTGCGACTTTTCTGCATCCAGCAGTGTCTGCAGATGGC
GGGTGAACAAGATCTGAGCAAGCTTTGACTGACTGTAGGCGGTTCCCGGG
TAATAGTGTTTTGTTCCGTTAATGTCCTTATAGTTGATGCGTCCAATGAG
ATTCACGCAGGAGCTGACGTTCACGATCCTGGAGTTCCTTCCCTCCTTGC
CTGCCGCCCTCAATTGAGGCAGAAGCAGGTGGGTGAGCAGAAAGTGTCCC
AGGAAGTTGATGGCAAAGTGCGACTCGTAGCCATCGGCGGTTAGTTTGAA
GGGCGCAAACATGATGCCAGCATTGTTCAGCAACAAATCCACTTTTGAAT
ACCGCTCCTTGATGAGCTGAGCAAATGCCTTTACGGATTTCAGATCCCCA
ACATCCAGTTGCTCGCAGATGAGCTTGCCCTTGGTAGCATTCAAGTCGAC
TATCGATGCAACTGCGGTTTCGGCAATTTTGGGATCACGAACGCCCATGA
CGACAGTCATGTCGCAGGCCAGCAGCTTCTCCACGATCCGCAGTCCGATG
CCGCGATTGCCTCCGGTGATGACAGCAATGCGGTCCGGGTGTTTATAAA

BO08052.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-PB 1068 CG11200-RB 185..1065 899..19 4380 99.8 Minus
CG11200-PA 1068 CG11200-RA 185..1065 899..19 4380 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-RC 1335 CG11200-RC 337..1217 899..19 4390 99.9 Minus
CG11200-RA 1447 CG11200-RA 449..1329 899..19 4390 99.9 Minus
CG11200-RB 1688 CG11200-RB 690..1570 899..19 4390 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20304635..20305028 19..412 1970 100 Plus
2R 25286936 2R 20305086..20305468 413..795 1915 100 Plus
2R 25286936 2R 20306243..20306348 794..899 515 99.1 Plus
Blast to na_te.dros performed on 2015-02-11 17:53:55 has no hits.

BO08052.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:36:30 Download gff for BO08052.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-PB 188..1068 15..896 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:26:09 Download gff for BO08052.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-PA 188..1068 15..896 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:45:39 Download gff for BO08052.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 693..1573 15..896 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:19:33 Download gff for BO08052.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 693..1573 15..896 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:19:33 Download gff for BO08052.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 20306244..20306345 795..896 99   Plus
2R 20305086..20305467 413..794 100 <- Plus
2R 20304631..20305028 15..412 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:45:39 Download gff for BO08052.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16193749..16193850 795..896 99   Plus
arm_2R 16192591..16192972 413..794 100 <- Plus
arm_2R 16192136..16192533 15..412 99 <- Plus

BO08052.5prime Sequence

867 bp (845 high quality bases) assembled on 2006-01-06

> BO08052.5prime
GAAGTTATCAGTCGACATGTTGGGAACTTTGCTGTGGATTTTCTTCGTCG
GCCTGCTGCTGTGTGCGTTCCTCTTTTCGAAGACCACCAAGGAGTTCCCG
AAGTCCTGGTTCGAGTGGAAGACTGAGTTTCGGTATCAGTACCTGGGAAT
CGTTGGGCTCGTCCACGATGCCCAGTATAAGGCACGGGATCGAGTGGCAC
TTTATAAACAACCGGACCGCATTGCTGTCATCACCGGAGGCAATCGCGGC
ATCGGACTGCGGATCGTGGAGAAGCTGCTGGCCTGCGACATGACTGTCGT
CATGGGCGTTCGTGATCCCAAAATTGCCGAAACCGCAGTTGCATCGATAG
TCGACTTGAATGCTACCAAGGGCAAGCTCATCTGCGAGCAACTGGATGTT
GGGGATCTGAAATCCGTAAAGGCATTTGCTCAGCTCATCAAGGAGCGGTA
TTCAAAAGTGGATTTGTTGCTGAACAATGCTGGCATCATGTTTGCGCCCT
TCAAACTAACCGCCGATGGCTACGAGTCGCACTTTGCCATCAACTTCCTG
GGACACTTTCTGCTCACCCACCTGCTTCTGCCTCAATTGAGGGCGGCAGG
CAAGGAGGGAAGGAACTCCAGGATCGTGAACGTCAGCTCCTGCGTGAATC
TCATTGGACGCATCAACTATAAGGACATTAACGGAACAAAACACTATTAC
CCGGGAACCGCCTACAGTCAGTCAAAGCTTGCTCAGATCTTGTTCACCCG
CCATCTGCAGACACTGCTGGATGCAGAAAAGTCGCACGTGCAGGTCAATG
TGGTGCATCCGGGCATTGTGGACACGGATCTGTTCGAGCACTCGGCCACC
ACATCGGTGCCCATTTT

BO08052.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-PB 1068 CG11200-RB 1..851 17..867 4255 100 Plus
CG11200-PA 1068 CG11200-RA 1..851 17..867 4255 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 22:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-RC 1335 CG11200-RC 153..1003 17..867 4255 100 Plus
CG11200-RA 1447 CG11200-RA 265..1115 17..867 4255 100 Plus
CG11200-RB 1688 CG11200-RB 506..1356 17..867 4255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 22:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20305086..20305468 687..305 1915 100 Minus
2R 25286936 2R 20306415..20306595 197..17 905 100 Minus
2R 25286936 2R 20304849..20305028 867..688 900 100 Minus
2R 25286936 2R 20306243..20306352 306..197 550 100 Minus
Blast to na_te.dros performed on 2015-02-11 22:06:06 has no hits.

BO08052.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:36:30 Download gff for BO08052.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-PB 1..851 17..867 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:26:10 Download gff for BO08052.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-PA 1..851 17..867 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:47:18 Download gff for BO08052.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 501..1356 11..867 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:03:24 Download gff for BO08052.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 501..1356 11..867 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:03:24 Download gff for BO08052.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 20306415..20306600 11..197 98   Minus
2R 20306244..20306351 198..305 100 <- Minus
2R 20305086..20305467 306..687 100 <- Minus
2R 20304849..20305028 688..867 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:47:18 Download gff for BO08052.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16193920..16194105 11..197 98   Minus
arm_2R 16193749..16193856 198..305 100 <- Minus
arm_2R 16192591..16192972 306..687 100 <- Minus
arm_2R 16192354..16192533 688..867 100 <- Minus

BO08052.complete Sequence

1099 bp (1099 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ631029

> BO08052.complete
GAAGTTATCAGTCGACATGTTGGGAACTTTGCTGTGGATTTTCTTCGTCG
GCCTGCTGCTGTGTGCGTTCCTCTTTTCGAAGACCACCAAGGAGTTCCCG
AAGTCCTGGTTCGAGTGGAAGACTGAGTTTCGGTATCAGTACCTGGGAAT
CGTTGGGCTCGTCCACGATGCCCAGTATAAGGCACGGGATCGAGTGGCAC
TTTATAAACAACCGGACCGCATTGCTGTCATCACCGGAGGCAATCGCGGC
ATCGGACTGCGGATCGTGGAGAAGCTGCTGGCCTGCGACATGACTGTCGT
CATGGGCGTTCGTGATCCCAAAATTGCCGAAACCGCAGTTGCATCGATAG
TCGACTTGAATGCTACCAAGGGCAAGCTCATCTGCGAGCAACTGGATGTT
GGGGATCTGAAATCCGTAAAGGCATTTGCTCAGCTCATCAAGGAGCGGTA
TTCAAAAGTGGATTTGTTGCTGAACAATGCTGGCATCATGTTTGCGCCCT
TCAAACTAACCGCCGATGGCTACGAGTCGCACTTTGCCATCAACTTCCTG
GGACACTTTCTGCTCACCCACCTGCTTCTGCCTCAATTGAGGGCGGCAGG
CAAGGAGGGAAGGAACTCCAGGATCGTGAACGTCAGCTCCTGCGTGAATC
TCATTGGACGCATCAACTATAAGGACATTAACGGAACAAAACACTATTAC
CCGGGAACCGCCTACAGTCAGTCAAAGCTTGCTCAGATCTTGTTCACCCG
CCATCTGCAGACACTGCTGGATGCAGAAAAGTCGCACGTGCAGGTCAATG
TGGTGCATCCGGGCATTGTGGACACGGATCTGTTCGAGCACTCGGCCACC
ACATCGGTGCCCATTTTCAAGAAGCTATTCTTCAAGACTCCGGAAAGGGG
ATCCCGCACGGTGGTCTTCGCGGCCATTGATCCCTCCATCGAGGGTCAGG
GTGGTACTTACCTCTCCAACGGCGGAAAGGGTCCTTTCCATCCGGATGCC
AAGAAGCCGGCAAAGTGCGAGCAGCTTTTCCAGTTCTCCTGCGACCTGTT
GAAAATCCAGCAGTACGGAAATGGCGAATACGCAAGCTTTCTAGACCAT

BO08052.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-RC 1068 CG11200-PC 1..1065 17..1081 5325 100 Plus
CG11200-RA 1068 CG11200-PA 1..1065 17..1081 5325 100 Plus
CG11200-RB 1068 CG11200-PB 1..1065 17..1081 5325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-RC 1335 CG11200-RC 153..1217 17..1081 5325 100 Plus
CG11200-RA 1447 CG11200-RA 265..1329 17..1081 5325 100 Plus
CG11200-RB 1688 CG11200-RB 506..1570 17..1081 5325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20304635..20305028 1081..688 1970 100 Minus
2R 25286936 2R 20305086..20305468 687..305 1915 100 Minus
2R 25286936 2R 20306415..20306595 197..17 905 100 Minus
2R 25286936 2R 20306243..20306352 306..197 550 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:46:52 has no hits.

BO08052.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:13:39 Download gff for BO08052.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RA 1..1068 17..1085 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:34:54 Download gff for BO08052.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RA 530..1602 11..1085 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:32:51 Download gff for BO08052.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 511..1570 22..1083 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:13:39 Download gff for BO08052.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RA 530..1602 11..1085 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:26:21 Download gff for BO08052.complete
Subject Subject Range Query Range Percent Splice Strand
CG11200-RB 511..1570 22..1083 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:26:21 Download gff for BO08052.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20306415..20306590 22..197 100   Minus
2R 20306244..20306351 198..305 100 <- Minus
2R 20305086..20305467 306..687 100 <- Minus
2R 20304633..20305028 688..1083 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:32:51 Download gff for BO08052.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16193920..16194095 22..197 100   Minus
arm_2R 16193749..16193856 198..305 100 <- Minus
arm_2R 16192591..16192972 306..687 100 <- Minus
arm_2R 16192138..16192533 688..1083 99 <- Minus

BO08052.pep Sequence

Translation from 16 to 1099

> BO08052.pep
MLGTLLWIFFVGLLLCAFLFSKTTKEFPKSWFEWKTEFRYQYLGIVGLVH
DAQYKARDRVALYKQPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRD
PKIAETAVASIVDLNATKGKLICEQLDVGDLKSVKAFAQLIKERYSKVDL
LLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRN
SRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTL
LDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKKLFFKTPERGSRTVV
FAAIDPSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQLFQFSCDLLKIQQY
GNGEYASFLDH

BO08052.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11200-PC 355 CG11200-PC 1..355 1..355 1848 100 Plus
CG11200-PA 355 CG11200-PA 1..355 1..355 1848 100 Plus
CG11200-PB 355 CG11200-PB 1..355 1..355 1848 100 Plus
CG3842-PD 406 CG3842-PD 75..351 68..345 463 40.8 Plus
CG3842-PC 406 CG3842-PC 75..351 68..345 463 40.8 Plus