Clone BO08142 Report

Search the DGRC for BO08142

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:81
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptArr1-RA
Protein status:BO08142.pep: validated full length
Sequenced Size:1126

Clone Sequence Records

BO08142.3prime Sequence

866 bp (865 high quality bases) assembled on 2006-01-06

> BO08142.3prime
ATGGTCTAGAAAGCTTGCGGCCTCAATGGAGCCCTCGGCTTCCAGTTGGG
CCTTGCGACTTGGCTTCGGGTGCATCAGAATAAATGGTAGCTCAGCGCAG
AGCTCGCCGCCCAGGGCTCCCAAGAAAAGCTTGACCTTCACAGCATATGA
AACAATTATGCCAAAGGCATCCCTCGCATCCTGACTGGCAATAAGTGTGG
TCGAGGCCAGAGCTGTGTCTTTGCGCTTGATATCACCCTCAACGGCGATG
CCTGCGCGGTCGCAATTGGCCACCAGGGTGGGCACCAGATACATGACCTT
CTGCAGGCTGGATCCCGGGTTCAGGGGACATCCCTCGCTCGTCTCCATGA
AGGCGATCGTGTTGCGGAACTGACCGTTCTGGAACAGGACCACATCGACG
CCCTGCTGCACCATGGCCTTGATCTTCTTCACCACCTTGTTGGAGTTGTT
GCGCACGCAGATGTTCACCGAGATCTTCTCGCCGTGATGGTACAGCTGCT
TGTCGAGGGTGACCTCCAGTTCGAGCTCTCCGGGCGACAGAAGGAAGTCC
TTGCGAACGACGGTGCAGGGCTGGATGCCCTGCTTGGTCGGTGCGTACTG
CACCTTGCGGATGCCCAGGTTAATGGTGCTCCTGCGATGCGATCGATCGC
AGTCGCTGTCTCCGGTAAAGATCTTTACGAAGTACTGGACTCCGCAGGGC
TGGCTCTCGTCACTGGCCTTCTGCTGGAGAACCACCGAGGCCGGCGAGCT
TGGTGGCATCTGCATCACGAAGGGATAGGCATTGGAGCCAAGCTTCTTCA
GCAGACGCTCCTGCATCTTGGTCAACTGGATGTCCTGCTTCTGGGGTGGG
CACACCTGCTGCGAGA

BO08142.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG5711-PA 1095 Arr1-RA 245..1092 866..19 4240 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-RC 1356 CG5711-RC 285..1132 866..19 4240 100 Minus
Arr1-RB 2327 CG5711-RB 364..1211 866..19 4240 100 Minus
Arr1-RA 1435 CG5711-RA 364..1211 866..19 4240 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18079051..18079723 866..194 3365 100 Minus
2L 23513712 2L 18079957..18080086 193..64 650 100 Minus
2L 23513712 2L 18080145..18080191 65..19 235 100 Minus
Blast to na_te.dros performed on 2015-02-12 04:38:52 has no hits.

BO08142.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:39:09 Download gff for BO08142.3prime
Subject Subject Range Query Range Percent Splice Strand
Arr1-PA 246..1095 15..865 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:30:02 Download gff for BO08142.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5711-PA 246..1095 15..865 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:38:52 Download gff for BO08142.3prime
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 365..1217 12..865 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:10:41 Download gff for BO08142.3prime
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 365..1217 12..865 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:10:41 Download gff for BO08142.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18080147..18080195 14..63 94 -> Minus
2L 18079957..18080086 64..193 100 -> Minus
2L 18079052..18079723 194..865 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:38:52 Download gff for BO08142.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18080147..18080195 14..63 94 -> Minus
arm_2L 18079957..18080086 64..193 100 -> Minus
arm_2L 18079052..18079723 194..865 100 -> Minus

BO08142.5prime Sequence

989 bp (823 high quality bases) assembled on 2006-01-06

> BO08142.5prime
GAAGTTATCAGTCGACATGGTGGTCAATTTCAAGGTGTTCAAGAAGTGTT
CCCCGAACAACATGATCACGCTCTACATGAACAGGCGTGATTTTGTAGAT
TCCGTGACTCAGGTGGAACCCATTGATGGAATCATTGTGCTGGACGATGA
GTACGTGCGCCAGAACCGCAAGATCTTCGTGCAGTTGGTCTGCAATTTCC
GATATGGGCGCGAGGACGACGAGATGATCGGTCTGCGGTTCCAGAAGGAA
CTGACCCTGGTCTCGCAGCAGGTGTGCCCACCCCAGAAGCAGGACATCCA
GTTGACCAAGATGCAGGAGCGTCTGCTGAAGAAGCTTGGCTCCAATGCCT
ATCCCTTCGTGATGCAGATGCCACCAAGCTCGCCGGCCTCGGTGGTTCTC
CAGCAGAAGGCCAGTGACGAGAGCCAGCCCTGCGGAGTCCAGTACTTCGT
AAAGATCTTTACCGGAGACAGCGACTGCGATCGATCGCATCGCAGGAGCA
CCATTAACCTGGGCATCCGCAAGGTGCAGTACGCACCGACCAAGCAGGGC
ATCCAGCCCTGCACCGTCGTTCGCAAGGACTTCCTTCTGTCGCCCGGAGA
GCTCGAACTGGAGGTCACCCTCGACAAGCAGCTGTACCATCACGGCGAGA
AGATCTCGGTGAACATCTGCGTGCGCAACAACTCCAACAAGGTGGTGAAG
AAGATCAAGGCCATGGTGCAGCAGGGCGTCGATGTGGTCCTGTTCCAGAA
CGGTCAGTTCCGCAACACGATCGCCTTCATGGAGACGAGCGAGGGATGTC
CCCTGAACCCGGGATCCAGCCTGCAGAAGGTCATGTATCTGGTGCCCACC
CTGGTGGCCAATTGCGACCGCGCAGGCATCGCCGTTGAGGGTGATATCAA
GCGCAAGACACAGCTCTGGGCTCGACCACACTTATTGCCAGTCAAGATGC
GAGGGATGCCTTTGGCATAATTGTTTCATATGCTGTGAA

BO08142.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG5711-PA 1095 Arr1-RA 1..890 17..906 4450 100 Plus
CG5711-PA 1095 Arr1-RA 890..974 905..989 375 97.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-RB 2327 CG5711-RB 120..1093 17..989 4815 99.7 Plus
Arr1-RA 1435 CG5711-RA 120..1093 17..989 4815 99.7 Plus
Arr1-RC 1356 CG5711-RC 150..1014 126..989 4270 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18078915..18079723 125..932 3980 99.8 Plus
2L 23513712 2L 18078388..18078496 17..125 545 100 Plus
2L 23513712 2L 18079957..18080013 933..989 270 98.2 Plus
Blast to na_te.dros performed on 2015-02-12 04:38:59 has no hits.

BO08142.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:39:10 Download gff for BO08142.5prime
Subject Subject Range Query Range Percent Splice Strand
Arr1-PA 1..972 17..987 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:30:04 Download gff for BO08142.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5711-PA 1..972 17..987 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:38:54 Download gff for BO08142.5prime
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 110..1093 9..989 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:11:09 Download gff for BO08142.5prime
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 110..1093 9..989 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:11:09 Download gff for BO08142.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18079957..18080013 933..989 98   Plus
2L 18078916..18079723 126..932 99 -> Plus
2L 18078378..18078496 9..125 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:38:54 Download gff for BO08142.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18079957..18080013 933..989 98   Plus
arm_2L 18078916..18079723 126..932 99 -> Plus
arm_2L 18078378..18078496 9..125 96 -> Plus

BO08142.complete Sequence

1126 bp (1126 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ631074

> BO08142.complete
GAAGTTATCAGTCGACATGGTGGTCAATTTCAAGGTGTTCAAGAAGTGTT
CCCCGAACAACATGATCACGCTCTACATGAACAGGCGTGATTTTGTAGAT
TCCGTGACTCAGGTGGAACCCATTGATGGAATCATTGTGCTGGACGATGA
GTACGTGCGCCAGAACCGCAAGATCTTCGTGCAGTTGGTCTGCAATTTCC
GATATGGGCGCGAGGACGACGAGATGATCGGTCTGCGGTTCCAGAAGGAA
CTGACCCTGGTCTCGCAGCAGGTGTGCCCACCCCAGAAGCAGGACATCCA
GTTGACCAAGATGCAGGAGCGTCTGCTGAAGAAGCTTGGCTCCAATGCCT
ATCCCTTCGTGATGCAGATGCCACCAAGCTCGCCGGCCTCGGTGGTTCTC
CAGCAGAAGGCCAGTGACGAGAGCCAGCCCTGCGGAGTCCAGTACTTCGT
AAAGATCTTTACCGGAGACAGCGACTGCGATCGATCGCATCGCAGGAGCA
CCATTAACCTGGGCATCCGCAAGGTGCAGTACGCACCGACCAAGCAGGGC
ATCCAGCCCTGCACCGTCGTTCGCAAGGACTTCCTTCTGTCGCCCGGAGA
GCTCGAACTGGAGGTCACCCTCGACAAGCAGCTGTACCATCACGGCGAGA
AGATCTCGGTGAACATCTGCGTGCGCAACAACTCCAACAAGGTGGTGAAG
AAGATCAAGGCCATGGTGCAGCAGGGCGTCGATGTGGTCCTGTTCCAGAA
CGGTCAGTTCCGCAACACGATCGCCTTCATGGAGACGAGCGAGGGATGTC
CCCTGAACCCGGGATCCAGCCTGCAGAAGGTCATGTATCTGGTGCCCACC
CTGGTGGCCAATTGCGACCGCGCAGGCATCGCCGTTGAGGGTGATATCAA
GCGCAAAGACACAGCTCTGGCCTCGACCACACTTATTGCCAGTCAGGATG
CGAGGGATGCCTTTGGCATAATTGTTTCATATGCTGTGAAGGTCAAGCTT
TTCTTGGGAGCCCTGGGCGGCGAGCTCTGCGCTGAGCTACCATTTATTCT
GATGCACCCGAAGCCAAGTCGCAAGGCCCAACTGGAAGCCGAGGGCTCCA
TTGAGGCCGCAAGCTTTCTAGACCAT

BO08142.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-RB 1095 CG5711-PB 1..1092 17..1108 5460 100 Plus
Arr1-RA 1095 CG5711-PA 1..1092 17..1108 5460 100 Plus
Arr1-RC 1053 CG5711-PC 68..1050 126..1108 4915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-RB 2327 CG5711-RB 120..1211 17..1108 5460 100 Plus
Arr1-RA 1435 CG5711-RA 120..1211 17..1108 5460 100 Plus
Arr1-RC 1356 CG5711-RC 150..1132 126..1108 4915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18078915..18079723 125..933 4045 100 Plus
2L 23513712 2L 18079957..18080086 934..1063 650 100 Plus
2L 23513712 2L 18078388..18078496 17..125 545 100 Plus
2L 23513712 2L 18080145..18080191 1062..1108 235 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:59:29 has no hits.

BO08142.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:12:55 Download gff for BO08142.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 1..1095 17..1112 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:33:58 Download gff for BO08142.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 113..1220 9..1115 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:04:03 Download gff for BO08142.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 120..1211 17..1110 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:12:55 Download gff for BO08142.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 113..1220 9..1115 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:30:35 Download gff for BO08142.complete
Subject Subject Range Query Range Percent Splice Strand
Arr1-RA 120..1211 17..1110 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:30:35 Download gff for BO08142.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18080147..18080191 1064..1110 95   Plus
2L 18079957..18080086 934..1063 100 -> Plus
2L 18078916..18079723 126..933 100 -> Plus
2L 18078388..18078496 17..125 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:04:03 Download gff for BO08142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18080147..18080191 1064..1110 95   Plus
arm_2L 18079957..18080086 934..1063 100 -> Plus
arm_2L 18078916..18079723 126..933 100 -> Plus
arm_2L 18078388..18078496 17..125 100 -> Plus

BO08142.pep Sequence

Translation from 16 to 1126

> BO08142.pep
MVVNFKVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQN
RKIFVQLVCNFRYGREDDEMIGLRFQKELTLVSQQVCPPQKQDIQLTKMQ
ERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDESQPCGVQYFVKIFTG
DSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELEV
TLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRN
TIAFMETSEGCPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTA
LASTTLIASQDARDAFGIIVSYAVKVKLFLGALGGELCAELPFILMHPKP
SRKAQLEAEGSIEAASFLDH

BO08142.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
Arr1-PB 364 CG5711-PB 1..364 1..364 1866 100 Plus
Arr1-PA 364 CG5711-PA 1..364 1..364 1866 100 Plus
Arr1-PC 350 CG5711-PC 21..350 35..364 1676 99.4 Plus
krz-PB 470 CG1487-PB 48..396 6..353 931 50.6 Plus
krz-PA 470 CG1487-PA 48..396 6..353 931 50.6 Plus