Clone BO08149 Report

Search the DGRC for BO08149

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:81
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG13698-RB
Protein status:BO08149.pep: validated full length
Sequenced Size:982

Clone Sequence Records

BO08149.3prime Sequence

942 bp (840 high quality bases) assembled on 2006-01-06

> BO08149.3prime
ATGGTCTAGAAAGCTTGCCACCTCGGTGCTGTGCGTCTGAATTCGGACCT
TCTTCACGCTTCCATTGCGCCGCATAGGTGGCGAGCTTCCGGATCCAGAA
TAGCCGGGATTTTGAATGCCTAACGTTGGATCCGGCCGTGGTCTCGGCTT
CTTCAGACTCGATCGCAGCGGTGAACGAGTCACCGAGTCAAGGGTGGATC
CATTGGACACGCTGGTCACGGTGGTGCTCATGGAGGCCACGCTGCCCGCC
GTTCCCGCTCCATTCCGGATTCCGCTGTAGGGCTTACCGGATGCGTCCGT
CACCGAAACGCCGTTGCGACTGCGAGGCTCCTTGAAACCAGGATTATTGA
ACGTAGTGGCACTGCCCGGAGATGACACATCCAGCGCCATTGTGGGATCT
CCGCCTGGACTGCGCGAGTAGATCACATCGTACAGGGCGGCCACGAACAG
AGCAATTGTCAAAACAATAGCCACAATCTGTATATAGAAGGAAATGCCCC
GCGATATCTTGAAGCCATAGCGCTCCTGCTCATCAATTTGCAGAGCAAAC
AAAACCGTCGCTATGATGGCCAGTACACCTCCCAGCAATGCCAACATTAA
CTTCACTATCACTAGAGTTGTGTAGGGCATAACCACCTTCTCCCTGGATG
AGATCATCGCGTGTTGAATGACCGACAGAATGCAGAAGATGCCCAGCACA
GCTGAGCTGCCAATGGCCAAGAGTCCACTGACAAAAACCGCATTACTTAA
TCTAAACTTGGACACGTCGTTGCCGCATTTCTCGCGATTATAAGTCAATT
GCTTGCAGACCTTAAACGGTCCGAAATAACCTCGATCGAAGTCATAGCCG
CCCGATGGACTATCGTAGTAACCCCCAATGGGTATGCCAATGGCCACAGA
TGCCAAGGCGAAGCAAATAAAGCCAAGACGGGTCACCCCAGC

BO08149.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-PB 951 CG13698-RB 25..948 942..19 4545 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-RC 1617 CG13698-RC 642..1565 942..19 4575 99.7 Minus
CG13698-RB 2418 CG13698-RB 728..1651 942..19 4575 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18089184..18089646 19..481 2315 100 Plus
3L 28110227 3L 18090009..18090176 576..743 840 100 Plus
3L 28110227 3L 18090279..18090387 744..852 545 100 Plus
3L 28110227 3L 18089846..18089948 478..580 515 100 Plus
3L 28110227 3L 18090447..18090538 851..942 415 96.7 Plus
Blast to na_te.dros performed on 2015-02-13 16:35:51 has no hits.

BO08149.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:39:22 Download gff for BO08149.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-PB 25..951 15..942 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:30:21 Download gff for BO08149.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-PB 25..951 15..942 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:14:03 Download gff for BO08149.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 728..1655 14..942 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 19:23:13 Download gff for BO08149.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 728..1655 14..942 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 19:23:13 Download gff for BO08149.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 18090448..18090538 852..942 96   Plus
3L 18090279..18090386 744..851 100 <- Plus
3L 18090012..18090176 579..743 100 <- Plus
3L 18089846..18089946 478..578 100 <- Plus
3L 18089180..18089642 14..477 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:14:03 Download gff for BO08149.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18083548..18083638 852..942 96   Plus
arm_3L 18083379..18083486 744..851 100 <- Plus
arm_3L 18083112..18083276 579..743 100 <- Plus
arm_3L 18082946..18083046 478..578 100 <- Plus
arm_3L 18082280..18082742 14..477 99 <- Plus

BO08149.5prime Sequence

838 bp (828 high quality bases) assembled on 2006-01-06

> BO08149.5prime
GAAGTTATCAGTCGACATGGCAAAGTCGACACTTTATGCTGCTGGGGTGA
CCTGTCTGGGCTTTATTTGCTTCGCCTTGGCATCTGTGGCCATTGGCATA
CCCATTTGGGGTTACTACGATAGTCCATCGGGCGGCTATGACTTCGATCG
AGGTTATTTCGGACCGTTTAAGGTCTGCAAGCAATTGACTTATAATCGCG
AGAAATGCGGCAACGACGTGTCCAAGTTTAGATTAAGTAATGCGGTTTTT
GTCAGTGGACTCTTGGCCATTGGCAGCTCAGCTGTGCTGGGCATCTTCTG
CATTCTGTCGGTCATTCAACACGCGATGATCTCATCCAGGGAGAAGGTGG
TTATGCCCTACACAACTCTAGTGATAGTGAAGTTAATGTTGGCATTGCTG
GGAGGTGTACTGGCCATCATAGCGACGGTTTTGTTTGCTCTGCAAATTGA
TGAGCAGGAGCGCTATGGCTTCAAGATATCGCGGGGCATTTCCTTCTATA
TACAGATTGTGGCTATTGTTTTGACAATTGCTCTGTTCGTGGCCGCCCTG
TACGATGTGATCTACTCGCGCAGTCCAGGCGGAGATCCCACAATGGCGCT
GGATGTGTCATCTCCGGGCAGTGCCACTACGTTCAATAATCCTGGTTTCA
AGGAGCCTCGCAGTCGCAACGGCGTTTCGGTGACGGACGCATCCGGTAAG
CCCTACAGCGGAATCCGGAATGGAGCGGGAACGGCGGGCAGCGTGGCCTC
CATGAGCACCACCGTGACCAGCGTGTCCAATGGATCCACCCTTGACTCGG
TGACTCGTTCACCGCTGCGATCGAGTCTGAAGAAGCCG

BO08149.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-PB 951 CG13698-RB 1..822 17..838 4110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-RC 1617 CG13698-RC 616..1439 15..838 4120 100 Plus
CG13698-RB 2418 CG13698-RB 702..1525 15..838 4120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18089310..18089646 838..502 1685 100 Minus
3L 28110227 3L 18090009..18090176 407..240 840 100 Minus
3L 28110227 3L 18090447..18090564 132..15 590 100 Minus
3L 28110227 3L 18090279..18090387 239..131 545 100 Minus
3L 28110227 3L 18089846..18089948 505..403 515 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:14:49 has no hits.

BO08149.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:39:24 Download gff for BO08149.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-PB 1..822 17..838 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:30:22 Download gff for BO08149.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-PB 1..822 17..838 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:58:20 Download gff for BO08149.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 693..1525 6..838 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:02:40 Download gff for BO08149.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 693..1525 6..838 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:02:40 Download gff for BO08149.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 18090448..18090573 6..131 96   Minus
3L 18090279..18090386 132..239 100 <- Minus
3L 18090012..18090176 240..404 100 <- Minus
3L 18089846..18089946 405..505 100 <- Minus
3L 18089310..18089642 506..838 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:58:20 Download gff for BO08149.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18083548..18083673 6..131 96   Minus
arm_3L 18083379..18083486 132..239 100 <- Minus
arm_3L 18083112..18083276 240..404 100 <- Minus
arm_3L 18082946..18083046 405..505 100 <- Minus
arm_3L 18082410..18082742 506..838 100 <- Minus

BO08149.complete Sequence

982 bp (982 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ631077

> BO08149.complete
GAAGTTATCAGTCGACATGGCAAAGTCGACACTTTATGCTGCTGGGGTGA
CCTGTCTGGGCTTTATTTGCTTCGCCTTGGCATCTGTGGCCATTGGCATA
CCCATTTGGGGTTACTACGATAGTCCATCGGGCGGCTATGACTTCGATCG
AGGTTATTTCGGACCGTTTAAGGTCTGCAAGCAATTGACTTATAATCGCG
AGAAATGCGGCAACGACGTGTCCAAGTTTAGATTAAGTAATGCGGTTTTT
GTCAGTGGACTCTTGGCCATTGGCAGCTCAGCTGTGCTGGGCATCTTCTG
CATTCTGTCGGTCATTCAACACGCGATGATCTCATCCAGGGAGAAGGTGG
TTATGCCCTACACAACTCTAGTGATAGTGAAGTTAATGTTGGCATTGCTG
GGAGGTGTACTGGCCATCATAGCGACGGTTTTGTTTGCTCTGCAAATTGA
TGAGCAGGAGCGCTATGGCTTCAAGATATCGCGGGGCATTTCCTTCTATA
TACAGATTGTGGCTATTGTTTTGACAATTGCTCTGTTCGTGGCCGCCCTG
TACGATGTGATCTACTCGCGCAGTCCAGGCGGAGATCCCACAATGGCGCT
GGATGTGTCATCTCCGGGCAGTGCCACTACGTTCAATAATCCTGGTTTCA
AGGAGCCTCGCAGTCGCAACGGCGTTTCGGTGACGGACGCATCCGGTAAG
CCCTACAGCGGAATCCGGAATGGAGCGGGAACGGCGGGCAGCGTGGCCTC
CATGAGCACCACCGTGACCAGCGTGTCCAATGGATCCACCCTTGACTCGG
TGACTCGTTCACCGCTGCGATCGAGTCTGAAGAAGCCGAGACCACGGCCG
GATCCAACGTTAGGCATTCAAAATCCCGGCTATTCTGGATCCGGAAGCTC
GCCACCTATGCGGCGCAATGGAAGCGTGAAGAAGGTCCGAATTCAGACGC
ACAGCACCGAGGTGGCAAGCTTTCTAGACCAT

BO08149.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-RC 951 CG13698-PC 1..948 17..964 4740 100 Plus
CG13698-RB 951 CG13698-PB 1..948 17..964 4740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-RC 1617 CG13698-RC 616..1565 15..964 4750 100 Plus
CG13698-RB 2418 CG13698-RB 702..1651 15..964 4750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18089184..18089646 964..502 2315 100 Minus
3L 28110227 3L 18090009..18090176 407..240 840 100 Minus
3L 28110227 3L 18090447..18090564 132..15 590 100 Minus
3L 28110227 3L 18090279..18090387 239..131 545 100 Minus
3L 28110227 3L 18089846..18089948 505..403 515 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:23:28 has no hits.

BO08149.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:12:42 Download gff for BO08149.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 1..951 17..968 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:33:47 Download gff for BO08149.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 674..1636 6..969 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:48:27 Download gff for BO08149.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 704..1651 17..966 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:12:42 Download gff for BO08149.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 674..1636 6..969 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:52:53 Download gff for BO08149.complete
Subject Subject Range Query Range Percent Splice Strand
CG13698-RB 704..1651 17..966 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:52:53 Download gff for BO08149.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18090448..18090562 17..131 100   Minus
3L 18090279..18090386 132..239 100 <- Minus
3L 18090012..18090176 240..404 100 <- Minus
3L 18089846..18089946 405..505 100 <- Minus
3L 18089182..18089642 506..966 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:48:27 Download gff for BO08149.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18083548..18083662 17..131 100   Minus
arm_3L 18083379..18083486 132..239 100 <- Minus
arm_3L 18083112..18083276 240..404 100 <- Minus
arm_3L 18082946..18083046 405..505 100 <- Minus
arm_3L 18082282..18082742 506..966 99 <- Minus

BO08149.pep Sequence

Translation from 16 to 982

> BO08149.pep
MAKSTLYAAGVTCLGFICFALASVAIGIPIWGYYDSPSGGYDFDRGYFGP
FKVCKQLTYNREKCGNDVSKFRLSNAVFVSGLLAIGSSAVLGIFCILSVI
QHAMISSREKVVMPYTTLVIVKLMLALLGGVLAIIATVLFALQIDEQERY
GFKISRGISFYIQIVAIVLTIALFVAALYDVIYSRSPGGDPTMALDVSSP
GSATTFNNPGFKEPRSRNGVSVTDASGKPYSGIRNGAGTAGSVASMSTTV
TSVSNGSTLDSVTRSPLRSSLKKPRPRPDPTLGIQNPGYSGSGSSPPMRR
NGSVKKVRIQTHSTEVASFLDH

BO08149.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13698-PC 316 CG13698-PC 1..316 1..316 1602 100 Plus
CG13698-PB 316 CG13698-PB 1..316 1..316 1602 100 Plus