Clone BO08205 Report

Search the DGRC for BO08205

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:82
Well:5
Vector:pDNR-Dual
Associated Gene/Transcripttmod-RB
Protein status:BO08205.pep: validated full length
Sequenced Size:1243

Clone Sequence Records

BO08205.3prime Sequence

953 bp (894 high quality bases) assembled on 2006-01-06

> BO08205.3prime
ATGGTCTAGAAAGCTTGCTTTACGCTGGTTCAGGCGTTTCACACGTATTC
TGTCGATGTTGCGCTGCAGGTGAGCGGCCACTCGGTGGCGGGCGTCGTTG
AACTCCAGGTGCAAGCCAAGGCGCAGCAGCGACGAGTTCTTCTCCACCAG
GTCGGTGATTTCCATCTCGATCTTGTTGCCCAGAACCGCAGACCGCTGAT
TGGAGGCCCTAAACTCCTCGATGGTGTGGCACTTGAGCAGGGCTTGCACC
AACTTAACAATCACGGGCGGACTGATAAAGTTGGTCTCGACATTTAATAC
TCTCAGGGTTTTGCTCTTCTCTATGGCCGCGGCTAACAGGAGGGCTGTCT
TGTCGGTGAGGCCCACATTTGTTAGCGAGAGGACTTCCAAATGTTCGTTC
TGAGGCAGTGCGGCAAACAGTTGCTCGAGTTTCTCGTCCGAGATGTTCTT
AATGTTGTTCAAGTTGAGGTCAATCAGCTTGGAGTCATCGTCCTTGACCC
GCTTGATGGATTCCTCCACATCTGTGTTGTTGGGCGGATCCATAGGGAAG
AGCTTCTGCTGAGTGGATTTCGTAATGCCATCCCATCCCAGGCCCACGGG
CTGACCCTTGTTGAGCAAGGAGGCGTGGTACTGGTCCTGATTCATCATCG
AGTGGAAGCCGAGGATGGCGGCCAGATCGATGATCTCCTCCTGCGTGGCA
TCGTTAAGGGCGTGTTCGTACTCCTCGCCCATGTCAATGGCGATTTGTTC
TTCGGCCTCGATGTCGCGGGCATCCCTTGGCGGTGGGACCCACTTCTTTC
CACGAACCTTGCCCTGAACGAACGGCTCGAACTCCGGCTGATCCGGGGTC
TCGATGGCCTGCTTATTGATGTGCTCGATCAGCTGCTTGCGATTGAGAGG
CCCGGTGGCTTCCTTGGTGCACTCATAGCTATTGCGCTGGTCTGGCGGCA
GGA

BO08205.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG1539-PD 1320 tmod-RD 383..1317 953..19 4675 100 Minus
CG1539-PF 1320 tmod-RF 383..1317 953..19 4675 100 Minus
CG1539-PC 1230 tmod-RC 293..1227 953..19 4675 100 Minus
CG1539-PA 1104 tmod-RA 167..1101 953..19 4675 100 Minus
CG1539-PB 1212 tmod-RB 275..1209 953..19 4675 100 Minus
CG1539-PE 1320 tmod-RE 383..1317 953..19 4675 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-RJ 2753 CG1539-RJ 679..1613 953..19 4675 100 Minus
tmod-RI 3000 CG1539-RI 926..1860 953..19 4675 100 Minus
tmod-RH 2717 CG1539-RH 643..1577 953..19 4675 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 18:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30572030..30572535 953..448 2530 100 Minus
3R 32079331 3R 30572597..30572850 449..196 1270 100 Minus
3R 32079331 3R 30572922..30573072 198..48 755 100 Minus
Blast to na_te.dros performed on 2015-02-11 18:02:45 has no hits.

BO08205.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:40:53 Download gff for BO08205.3prime
Subject Subject Range Query Range Percent Splice Strand
tmod-PC 294..1230 15..952 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:30 Download gff for BO08205.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1539-PE 384..1320 15..952 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:46:14 Download gff for BO08205.3prime
Subject Subject Range Query Range Percent Splice Strand
tmod-RH 644..1580 15..952 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:42:17 Download gff for BO08205.3prime
Subject Subject Range Query Range Percent Splice Strand
tmod-RH 644..1580 15..952 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:42:17 Download gff for BO08205.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 30577179..30577210 15..47 93   Minus
3R 30572925..30573072 48..195 100 -> Minus
3R 30572599..30572850 196..447 100 -> Minus
3R 30572031..30572535 448..952 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:46:14 Download gff for BO08205.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26402901..26402932 15..47 93   Minus
arm_3R 26398647..26398794 48..195 100 -> Minus
arm_3R 26398321..26398572 196..447 100 -> Minus
arm_3R 26397753..26398257 448..952 100 -> Minus

BO08205.5prime Sequence

922 bp (806 high quality bases) assembled on 2006-01-06

> BO08205.5prime
GAAGTTATCAGTCGACATGGAGAGTGCCCTGCCGGTGGCCGAGTTTCAGC
AGATAAAGCTGCGTCCGGTGCCAAAGGTCAAACGCCGAGCCCCTCAGCCG
CCAGTGAGCCTTCGCCTGAAGCATAAAAATACTTCTGCCACCACAAAGAC
AACCACGCTCACCACCCCCGCCAAACTGTATGGCAAGGATCTGAGTGAGT
ACGATGATGTGGATGTGGAGAGCCTGCTGGCCCAGCTCTCCCCCGAGGAG
ATAACCATACTGGCCAAAGAAGTGGATCCCGATGACAACTTCCTGCCGCC
AGACCAGCGCAATAGCTATGAGTGCACCAAGGAAGCCACCGGGCCTCTCA
ATCGCAAGCAGCTGATCGAGCACATCAATAAGCAGGCCATCGAGACCCCG
GATCAGCCGGAGTTCGAGCCGTTCGTTCAGGGCAAGGTTCGTGGAAAGAA
GTGGGTCCCACCGCCAAGGGATGCCCGCGACATCGAGGCCGAAGAACAAA
TCGCCATTGACATGGGCGAGGAGTACGAACACGCCCTTAACGATGCCACG
CAGGAGGAGATCATCGATCTGGCCGCCATCCTCGGCTTCCACTCGATGAT
GAATCAGGACCAGTACCACGCCTCCTTGCTCAACAAGGGTCAGCCCGTGG
GCCTGGGATGGGATGGCATTACGAAATCCACTCAGCAGAAGCTCTTCCCT
ATGGATCCGCCCAACAACACAGATGTGGAGGAATCCATCAAGCGGGTCAA
GGACGATGACTCCAAGCTGATTGACCTCAACTTGAACAACATTAAGAACA
TCTCGGACGAGAAACTCGAGCAACTGTTTGCCGCACTGCCTCAGAACGAA
CATTTGGAAGTCCTCTCGCTAACAAATGTGGGCCTCACCGACNAGACAGC
CCTTCTGTTAGCCCGCGGCATA

BO08205.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1539-PB 1212 tmod-RB 1..897 17..913 4441 99.7 Plus
CG1539-PD 1320 tmod-RD 223..1005 131..913 3871 99.7 Plus
CG1539-PF 1320 tmod-RF 223..1005 131..913 3871 99.7 Plus
CG1539-PC 1230 tmod-RC 133..915 131..913 3871 99.7 Plus
CG1539-PA 1104 tmod-RA 7..789 131..913 3871 99.7 Plus
CG1539-PE 1320 tmod-RE 223..1005 131..913 3871 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-RB 2508 CG1539-RB 160..1061 17..919 4464 99.7 Plus
tmod-RJ 2753 CG1539-RJ 519..1306 131..919 3894 99.6 Plus
tmod-RI 3000 CG1539-RI 766..1553 131..919 3894 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30572023..30572535 284..796 2565 100 Plus
3R 32079331 3R 30571809..30571962 131..284 770 100 Plus
3R 32079331 3R 30571316..30571429 17..130 570 100 Plus
3R 32079331 3R 30572597..30572715 795..913 569 98.3 Plus
Blast to na_te.dros performed on 2015-02-12 04:40:06 has no hits.

BO08205.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:40:54 Download gff for BO08205.5prime
Subject Subject Range Query Range Percent Splice Strand
tmod-PB 1..905 17..921 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:32:31 Download gff for BO08205.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1539-PB 1..905 17..921 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:39:17 Download gff for BO08205.5prime
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 150..1064 7..921 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:13:38 Download gff for BO08205.5prime
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 150..1064 7..921 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:13:38 Download gff for BO08205.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 30572599..30572723 797..921 96   Plus
3R 30572023..30572535 284..796 100 -> Plus
3R 30571809..30571961 131..283 100 -> Plus
3R 30571306..30571429 7..130 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:39:17 Download gff for BO08205.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26398321..26398445 797..921 96   Plus
arm_3R 26397745..26398257 284..796 100 -> Plus
arm_3R 26397531..26397683 131..283 100 -> Plus
arm_3R 26397028..26397151 7..130 96 -> Plus

BO08205.complete Sequence

1243 bp (1243 high quality bases) assembled on 2006-01-10

GenBank Submission: FJ631097

> BO08205.complete
GAAGTTATCAGTCGACATGGAGAGTGCCCTGCCGGTGGCCGAGTTTCAGC
AGATAAAGCTGCGTCCGGTGCCAAAGGTCAAACGCCGAGCCCCTCAGCCG
CCAGTGAGCCTTCGCCTGAAGCATAAAAATACTTCTGCCACCACAAAGAC
AACCACGCTCACCACCCCCGCCAAACTGTATGGCAAGGATCTGAGTGAGT
ACGATGATGTGGATGTGGAGAGCCTGCTGGCCCAGCTCTCCCCCGAGGAG
ATAACCATACTGGCCAAAGAAGTGGATCCCGATGACAACTTCCTGCCGCC
AGACCAGCGCAATAGCTATGAGTGCACCAAGGAAGCCACCGGGCCTCTCA
ATCGCAAGCAGCTGATCGAGCACATCAATAAGCAGGCCATCGAGACCCCG
GATCAGCCGGAGTTCGAGCCGTTCGTTCAGGGCAAGGTTCGTGGAAAGAA
GTGGGTCCCACCGCCAAGGGATGCCCGCGACATCGAGGCCGAAGAACAAA
TCGCCATTGACATGGGCGAGGAGTACGAACACGCCCTTAACGATGCCACG
CAGGAGGAGATCATCGATCTGGCCGCCATCCTCGGCTTCCACTCGATGAT
GAATCAGGACCAGTACCACGCCTCCTTGCTCAACAAGGGTCAGCCCGTGG
GCCTGGGATGGGATGGCATTACGAAATCCACTCAGCAGAAGCTCTTCCCT
ATGGATCCGCCCAACAACACAGATGTGGAGGAATCCATCAAGCGGGTCAA
GGACGATGACTCCAAGCTGATTGACCTCAACTTGAACAACATTAAGAACA
TCTCGGACGAGAAACTCGAGCAACTGTTTGCCGCACTGCCTCAGAACGAA
CATTTGGAAGTCCTCTCGCTAACAAATGTGGGCCTCACCGACAAGACAGC
CCTCCTGTTAGCCGCGGCCATAGAGAAGAGCAAAACCCTGAGAGTATTAA
ATGTCGAGACCAACTTTATCAGTCCGCCCGTGATTGTTAAGTTGGTGCAA
GCCCTGCTCAAGTGCCACACCATCGAGGAGTTTAGGGCCTCCAATCAGCG
GTCTGCGGTTCTGGGCAACAAGATCGAGATGGAAATCACCGACCTGGTGG
AGAAGAACTCGTCGCTGCTGCGCCTTGGCTTGCACCTGGAGTTCAACGAC
GCCCGCCACCGAGTGGCCGCTCACCTGCAGCGCAACATCGACAGAATACG
TGTGAAACGCCTGAACCAGCGTAAAGCAAGCTTTCTAGACCAT

BO08205.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-RB 1212 CG1539-PB 1..1209 17..1225 6045 100 Plus
tmod-RJ 1230 CG1539-PJ 133..1227 131..1225 5475 100 Plus
tmod-RI 1320 CG1539-PI 223..1317 131..1225 5475 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-RB 2508 CG1539-RB 160..1368 17..1225 6045 100 Plus
tmod-RJ 2753 CG1539-RJ 519..1613 131..1225 5475 100 Plus
tmod-RI 3000 CG1539-RI 766..1860 131..1225 5475 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30572023..30572535 284..796 2565 100 Plus
3R 32079331 3R 30572597..30572850 795..1048 1270 100 Plus
3R 32079331 3R 30571809..30571962 131..284 770 100 Plus
3R 32079331 3R 30572922..30573072 1046..1196 755 100 Plus
3R 32079331 3R 30571316..30571429 17..130 570 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:35:35 has no hits.

BO08205.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:11:15 Download gff for BO08205.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 1..1212 17..1229 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:32:00 Download gff for BO08205.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 150..1371 7..1229 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:22 Download gff for BO08205.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 160..1368 17..1227 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:11:15 Download gff for BO08205.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 150..1371 7..1229 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:24:25 Download gff for BO08205.complete
Subject Subject Range Query Range Percent Splice Strand
tmod-RB 160..1368 17..1227 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:24:25 Download gff for BO08205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30577179..30577207 1197..1227 93   Plus
3R 30572925..30573072 1049..1196 100 -> Plus
3R 30572599..30572850 797..1048 100 -> Plus
3R 30572023..30572535 284..796 100 -> Plus
3R 30571809..30571961 131..283 100 -> Plus
3R 30571316..30571429 17..130 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:22 Download gff for BO08205.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26402901..26402929 1197..1227 93   Plus
arm_3R 26398647..26398794 1049..1196 100 -> Plus
arm_3R 26398321..26398572 797..1048 100 -> Plus
arm_3R 26397745..26398257 284..796 100 -> Plus
arm_3R 26397531..26397683 131..283 100 -> Plus
arm_3R 26397038..26397151 17..130 100 -> Plus

BO08205.pep Sequence

Translation from 16 to 1243

> BO08205.pep
MESALPVAEFQQIKLRPVPKVKRRAPQPPVSLRLKHKNTSATTKTTTLTT
PAKLYGKDLSEYDDVDVESLLAQLSPEEITILAKEVDPDDNFLPPDQRNS
YECTKEATGPLNRKQLIEHINKQAIETPDQPEFEPFVQGKVRGKKWVPPP
RDARDIEAEEQIAIDMGEEYEHALNDATQEEIIDLAAILGFHSMMNQDQY
HASLLNKGQPVGLGWDGITKSTQQKLFPMDPPNNTDVEESIKRVKDDDSK
LIDLNLNNIKNISDEKLEQLFAALPQNEHLEVLSLTNVGLTDKTALLLAA
AIEKSKTLRVLNVETNFISPPVIVKLVQALLKCHTIEEFRASNQRSAVLG
NKIEMEITDLVEKNSSLLRLGLHLEFNDARHRVAAHLQRNIDRIRVKRLN
QRKASFLDH

BO08205.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
tmod-PB 403 CG1539-PB 1..403 1..403 2053 100 Plus
tmod-PI 439 CG1539-PI 66..439 30..403 1864 98.1 Plus
tmod-PL 439 CG1539-PL 66..439 30..403 1864 98.1 Plus
tmod-PA 367 CG1539-PA 3..367 39..403 1860 100 Plus
tmod-PH 372 CG1539-PH 8..372 39..403 1860 100 Plus