Clone BO08232 Report

Search the DGRC for BO08232

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:82
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptRab5-RA
Protein status:BO08232.pep: validated full length
Sequenced Size:691

Clone Sequence Records

BO08232.3prime Sequence

689 bp (688 high quality bases) assembled on 2006-01-06

> BO08232.3prime
ATGGTCTAGAAAGCTTGCCTTGCAGCAGTTGTTCGTCGGTCGATTTGTTT
CGGTTCCAGTCGGCCTTATGCTGGTTCCCTGATTGTTGGCGCCATCGTTC
TTAGGTAGTTTCTTGGCAATGGCCAAGAAGATGTCGTTCACATTCATGCC
CGTCTTGGCGGAGGTTTCCATGAACAGCAGCCCGTTCTCCTCGGCATATT
GCTTCGCTTCATCGAACTCTACGACGCGAATGTTTGACAAATCTGCCTTG
TTGCCGGCCAGCGCAATGACAATGTTTGGTGAGGCTTGTTTATGCAGTTC
CTTGACCCAGGTCTTCGCACGCTGAAAACTGTCCTGATTCTGTATATCAT
AGACGACAATAGCGGCCTGCGCTCCTCGATAATACATGGGAGCTAAGCTG
TGGTACCGCTCCTGGCCAGCCGTGTCCCAGATCTCGAACTTAACGACAGT
GTCCTCTATGCAAATAGTCTGTGTCAGAAAGGCCGCACCTATCGTGCTCT
CCTGGTACTCGTGGAACTGTCCCTTGACGAAGCGCAGCACCAGTGAGGAC
TTGCCCACAGCGGACTCGCCGAGGAGCACCAACTTGAATTGGCAGCTTTT
GTTCTGCGAGGTGCCATTGGGCCGCTGCGCCGTTCCAGTGCCGCTGGCAC
CGCCGCTGCGTGGAGTGGTTGCCATGTCGACTGATAACT

BO08232.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3664-PA 660 Rab5-RA 1..657 675..19 3285 100 Minus
CG3664-PB 660 Rab5-RB 1..657 675..19 3285 100 Minus
CG3664-PF 660 Rab5-RF 1..657 675..19 3285 100 Minus
CG3664-PD 660 Rab5-RD 1..657 675..19 3285 100 Minus
CG3664-PC 660 Rab5-RC 1..657 675..19 3285 100 Minus
CG3664-PE 660 Rab5-RE 1..657 675..19 3285 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-RI 1775 CG3664-RI 274..931 676..19 3290 100 Minus
Rab5-RH 1772 CG3664-RH 275..932 676..19 3290 100 Minus
Rab5-RG 1785 CG3664-RG 284..941 676..19 3290 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2361157..2361429 404..676 1365 100 Plus
2L 23513712 2L 2360633..2360801 117..285 845 100 Plus
2L 23513712 2L 2360971..2361093 285..407 615 100 Plus
2L 23513712 2L 2360472..2360570 19..117 495 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:01:48 has no hits.

BO08232.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:41:40 Download gff for BO08232.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab5-PB 1..660 16..675 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:33:36 Download gff for BO08232.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3664-PE 1..660 16..675 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 06:13:04 Download gff for BO08232.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 280..941 19..679 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:11:56 Download gff for BO08232.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 280..941 19..679 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:11:56 Download gff for BO08232.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 2361160..2361433 407..679 99   Plus
2L 2360972..2361092 286..406 100 <- Plus
2L 2360633..2360801 117..285 100 <- Plus
2L 2360472..2360569 19..116 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 06:13:04 Download gff for BO08232.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2361160..2361433 407..679 99   Plus
arm_2L 2360972..2361092 286..406 100 <- Plus
arm_2L 2360633..2360801 117..285 100 <- Plus
arm_2L 2360472..2360569 19..116 100 <- Plus

BO08232.5prime Sequence

689 bp (688 high quality bases) assembled on 2006-01-06

> BO08232.5prime
GAAGTTATCAGTCGACATGGCAACCACTCCACGCAGCGGCGGTGCCAGCG
GCACTGGAACGGCGCAGCGGCCCAATGGCACCTCGCAGAACAAAAGCTGC
CAATTCAAGTTGGTGCTCCTCGGCGAGTCCGCTGTGGGCAAGTCCTCACT
GGTGCTGCGCTTCGTCAAGGGACAGTTCCACGAGTACCAGGAGAGCACGA
TAGGTGCGGCCTTTCTGACACAGACTATTTGCATAGAGGACACTGTCGTT
AAGTTCGAGATCTGGGACACGGCTGGCCAGGAGCGGTACCACAGCTTAGC
TCCCATGTATTATCGAGGAGCGCAGGCCGCTATTGTCGTCTATGATATAC
AGAATCAGGACAGTTTTCAGCGTGCGAAGACCTGGGTCAAGGAACTGCAT
AAACAAGCCTCACCAAACATTGTCATTGCGCTGGCCGGCAACAAGGCAGA
TTTGTCAAACATTCGCGTCGTAGAGTTCGATGAAGCGAAGCAATATGCCG
AGGAGAACGGGCTGCTGTTCATGGAAACCTCCGCCAAGACGGGCATGAAT
GTGAACGACATCTTCTTGGCCATTGCCAAGAAACTACCTAAGAACGATGG
CGCCAACAATCAGGGAACCAGCATAAGGCCGACTGGAACCGAAACAAATC
GACCGACGAACAACTGCTGCAAGGCAAGCTTTCTAGACC

BO08232.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3664-PA 660 Rab5-RA 1..657 17..673 3285 100 Plus
CG3664-PB 660 Rab5-RB 1..657 17..673 3285 100 Plus
CG3664-PF 660 Rab5-RF 1..657 17..673 3285 100 Plus
CG3664-PD 660 Rab5-RD 1..657 17..673 3285 100 Plus
CG3664-PC 660 Rab5-RC 1..657 17..673 3285 100 Plus
CG3664-PE 660 Rab5-RE 1..657 17..673 3285 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-RI 1775 CG3664-RI 274..931 16..673 3290 100 Plus
Rab5-RH 1772 CG3664-RH 275..932 16..673 3290 100 Plus
Rab5-RG 1785 CG3664-RG 284..941 16..673 3290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2361157..2361429 288..16 1365 100 Minus
2L 23513712 2L 2360633..2360801 575..407 845 100 Minus
2L 23513712 2L 2360971..2361093 407..285 615 100 Minus
2L 23513712 2L 2360472..2360570 673..575 495 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:41:00 has no hits.

BO08232.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:41:41 Download gff for BO08232.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab5-PB 1..660 17..676 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:33:37 Download gff for BO08232.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3664-PE 1..660 17..676 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:50:43 Download gff for BO08232.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 280..941 13..673 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:08:35 Download gff for BO08232.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 280..941 13..673 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:08:35 Download gff for BO08232.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 2361160..2361433 13..285 99   Minus
2L 2360972..2361092 286..406 100 <- Minus
2L 2360633..2360801 407..575 100 <- Minus
2L 2360472..2360569 576..673 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:50:43 Download gff for BO08232.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2361160..2361433 13..285 99   Minus
arm_2L 2360972..2361092 286..406 100 <- Minus
arm_2L 2360633..2360801 407..575 100 <- Minus
arm_2L 2360472..2360569 576..673 100 <- Minus

BO08232.complete Sequence

691 bp (691 high quality bases) assembled on 2006-01-10

GenBank Submission: FJ631109

> BO08232.complete
GAAGTTATCAGTCGACATGGCAACCACTCCACGCAGCGGCGGTGCCAGCG
GCACTGGAACGGCGCAGCGGCCCAATGGCACCTCGCAGAACAAAAGCTGC
CAATTCAAGTTGGTGCTCCTCGGCGAGTCCGCTGTGGGCAAGTCCTCACT
GGTGCTGCGCTTCGTCAAGGGACAGTTCCACGAGTACCAGGAGAGCACGA
TAGGTGCGGCCTTTCTGACACAGACTATTTGCATAGAGGACACTGTCGTT
AAGTTCGAGATCTGGGACACGGCTGGCCAGGAGCGGTACCACAGCTTAGC
TCCCATGTATTATCGAGGAGCGCAGGCCGCTATTGTCGTCTATGATATAC
AGAATCAGGACAGTTTTCAGCGTGCGAAGACCTGGGTCAAGGAACTGCAT
AAACAAGCCTCACCAAACATTGTCATTGCGCTGGCCGGCAACAAGGCAGA
TTTGTCAAACATTCGCGTCGTAGAGTTCGATGAAGCGAAGCAATATGCCG
AGGAGAACGGGCTGCTGTTCATGGAAACCTCCGCCAAGACGGGCATGAAT
GTGAACGACATCTTCTTGGCCATTGCCAAGAAACTACCTAAGAACGATGG
CGCCAACAATCAGGGAACCAGCATAAGGCCGACTGGAACCGAAACAAATC
GACCGACGAACAACTGCTGCAAGGCAAGCTTTCTAGACCAT

BO08232.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-RI 660 CG3664-PI 1..657 17..673 3285 100 Plus
Rab5-RH 660 CG3664-PH 1..657 17..673 3285 100 Plus
Rab5-RG 660 CG3664-PG 1..657 17..673 3285 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-RI 1775 CG3664-RI 274..931 16..673 3290 100 Plus
Rab5-RH 1772 CG3664-RH 275..932 16..673 3290 100 Plus
Rab5-RG 1785 CG3664-RG 284..941 16..673 3290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2361157..2361429 288..16 1365 100 Minus
2L 23513712 2L 2360633..2360801 575..407 845 100 Minus
2L 23513712 2L 2360971..2361093 407..285 615 100 Minus
2L 23513712 2L 2360472..2360570 673..575 495 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:39:17 has no hits.

BO08232.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:00:33 Download gff for BO08232.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RF 1..660 17..676 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:32:38 Download gff for BO08232.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RF 216..877 13..673 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:49 Download gff for BO08232.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 285..941 17..675 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:00:33 Download gff for BO08232.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RF 216..877 13..673 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:50:51 Download gff for BO08232.complete
Subject Subject Range Query Range Percent Splice Strand
Rab5-RG 285..941 17..675 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:50:51 Download gff for BO08232.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2361160..2361428 17..285 100   Minus
2L 2360972..2361092 286..406 100 <- Minus
2L 2360633..2360801 407..575 100 <- Minus
2L 2360469..2360569 576..675 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:49 Download gff for BO08232.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2361160..2361428 17..285 100   Minus
arm_2L 2360972..2361092 286..406 100 <- Minus
arm_2L 2360633..2360801 407..575 100 <- Minus
arm_2L 2360469..2360569 576..675 98 <- Minus

BO08232.pep Sequence

Translation from 16 to 691

> BO08232.pep
MATTPRSGGASGTGTAQRPNGTSQNKSCQFKLVLLGESAVGKSSLVLRFV
KGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYR
GAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIR
VVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQG
TSIRPTGTETNRPTNNCCKASFLDH

BO08232.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Rab5-PI 219 CG3664-PI 1..219 1..219 1132 100 Plus
Rab5-PH 219 CG3664-PH 1..219 1..219 1132 100 Plus
Rab5-PG 219 CG3664-PG 1..219 1..219 1132 100 Plus
Rab5-PE 219 CG3664-PE 1..219 1..219 1132 100 Plus
Rab5-PC 219 CG3664-PC 1..219 1..219 1132 100 Plus