Clone BO08254 Report

Search the DGRC for BO08254

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:82
Well:54
Vector:pDNR-Dual
Associated Gene/Transcriptshf-RA
Protein status:BO08254.pep: validated full length
Sequenced Size:1402

Clone Sequence Records

BO08254.3prime Sequence

923 bp (791 high quality bases) assembled on 2006-01-06

> BO08254.3prime
ATGGTCTAGAAAGCTTGCGAACTTGGAGTCATCGTTTCGGTGGACATGTC
GTCGCTTGCGACCGTTGCAGTGGCGTCCATAGAATCCCGGATGGCACTTG
CAGTGCTTGTGGGAGACGCAGGTGCCATTGCGACACTTGCAGATGGAGCG
CTGCTTGCGCCCGATCTCGCAGTGATCGCCTCGTAGTCCGTTGGGGCAGC
GGCACAGGTTGTTCCCGATGCACCGTCCCTCGTTCTTGCAGGGGATCACA
CACTTGGAGTACTCGCAACGCAGGCCGTAGTAACCCTTGGAGCACTGGCA
CTTGTCCTTCTGTATACACTTGCCGCCATTCAAGCACTTGTCCTTGCAAA
TACCACCTTCGCACTGCGTGCCCTGGTAGCCCTCCGGACAGGTGCAGACG
GACGGCGCCGTGCAGTTACCGCCATTGAGACACTGCGGAAAACAGAAGGC
CGTCTCGCAGTATTGGCCCGTGTAGCCCACGTTGCACTTGCAGATGTGGT
GCTCGTTGCAGTACCCGTTCTTGCCGCACTTCAAGCTGCATTCTTGCAAA
GTTGTTAGTGAAGTAGGGTTGGAAGCGTCTATATCATACACACCTCTGTG
GGCGCATTCCTTTTTGAAGTTGAGGCGAATGGGTGTGCCCGAGAGCGGCT
TGTTGTGGCGCGTCTGGATCTTGAGGCCGACGTTGAAGGACGCGGTGCCG
GAGCTGTTGCCGGTGCAGGGCAGGAATATGCTAAAATTTTTCTGCTCCTG
CGGAATGCGTCCGCTCTTGCGAATGGACAGCGTTGGCGCCTTCAAGATAC
TTTCATCCATGGTCTGCAGGCGGTCAAAGTCGTAGAAGTATTTGCGGCGC
CCCGACTTCCATGTGAAGTTAACGTAGTTGACCTCCGATGGGATTACCAG
GAAGTGTACAGCGTCGTGTCCCT

BO08254.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3135-PA 1371 shf-RA 482..1368 905..19 4435 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
shf-RA 1784 CG3135-RA 723..1628 923..19 4505 99.9 Minus
shf-RB 1796 CG3135-RB 723..1640 923..19 4375 98.6 Minus
shf-RD 1745 CG3135-RD 1064..1589 544..19 2630 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6771732..6771934 55..257 1000 99.5 Plus
X 23542271 X 6773915..6774109 543..737 975 100 Plus
X 23542271 X 6773058..6773251 351..544 970 100 Plus
X 23542271 X 6774183..6774369 738..923 885 99.5 Plus
X 23542271 X 6772005..6772101 258..354 485 100 Plus
X 23542271 X 6771619..6771659 19..59 205 100 Plus
Blast to na_te.dros performed on 2015-02-12 04:41:03 has no hits.

BO08254.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:42:17 Download gff for BO08254.3prime
Subject Subject Range Query Range Percent Splice Strand
shf-PA 463..1371 18..923 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:34:33 Download gff for BO08254.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3135-PA 463..1371 18..923 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:39:33 Download gff for BO08254.3prime
Subject Subject Range Query Range Percent Splice Strand
shf-RA 723..1628 19..923 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:15:46 Download gff for BO08254.3prime
Subject Subject Range Query Range Percent Splice Strand
shf-RA 723..1628 19..923 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:15:46 Download gff for BO08254.3prime
Subject Subject Range Query Range Percent Splice Strand
X 6774183..6774369 738..923 99   Plus
X 6773915..6774109 543..737 100 <- Plus
X 6773061..6773249 354..542 100 <- Plus
X 6772005..6772100 258..353 100 <- Plus
X 6771737..6771934 60..257 100 <- Plus
X 6771619..6771659 19..59 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:39:33 Download gff for BO08254.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6668216..6668402 738..923 99   Plus
arm_X 6667948..6668142 543..737 100 <- Plus
arm_X 6667094..6667282 354..542 100 <- Plus
arm_X 6666038..6666133 258..353 100 <- Plus
arm_X 6665770..6665967 60..257 100 <- Plus
arm_X 6665652..6665692 19..59 100 <- Plus

BO08254.5prime Sequence

900 bp (829 high quality bases) assembled on 2006-01-06

> BO08254.5prime
GAAGTTATCAGTCGACATGACACATCAGGGCATCGGCTGCCTGGTCAAGT
GGTTATATCTGGTGCTGATCGTGCACACGCTCCTCTGCATCGGCCAGCTC
GAGTGTCGCCAGCAGCACCACAATCGGAATAACAATAATAATAACAGAAG
AGCGGACTCGTCCAGCTCAGAGGAGGGCCACGGCAACACCAGCGATGGCC
TGGACAACTTCGCAGATCAGGACGCCAGCTTCGTTGGCCATGGACACCAG
CCGCGTCGGGGTCAACGAAAGAAACAGCAGGGAGGTGGAGGAGGAGGCAG
CGGCGGCGGCGGCGGAAACGGAGGAGGCGGTGGAAGCCGGCACAATCGCA
ACGAGGAGAGCGGCATCTCGTTGTGGATCAATGAGCAGCAGCTCAAAATG
CTTACAGCGCTCTACTTCCCACAGGGCTACTCGGAGCGCCTGTACGCCAT
TCACAACAGCCGGGTGACCAATGATCTGAGGGACACGACGCTGTACAACT
TCCTGGTAATCCCATCGGAGGTCAACTACGTTAACTTCACATGGAAGTCG
GGGCGCCGCAAATACTTCTACGACTTTGACCGCCTGCAGACCATGGATGA
AAGTATCTTGAAGGCGCCAACGCTGTCCATTCGCAAGAGCGGACGCATTC
CGCAGGAGCAGAAAAATTTTAGCATATTCCTGCCCTGCACCGGCAACAGC
TCCGGCACCGCGTCCTTCAACGTCGGCCTCAAGATCCAGACGCGCCACAA
CAAGCCGCTCTCGGGCACACCCATTCGCCTCAACTTCAAAAAGGAATGCG
CCCACAGAGGTGTGTATGATATAGACGCTTCCNACCCTACTTCACTAACA
AACTTTGCAGAATGCAGCTTGAAGTGCGGCAAGAACGGGTACTGCAACGA

BO08254.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG3135-PA 1371 shf-RA 1..835 17..851 4156 99.8 Plus
CG3135-PA 1371 shf-RA 843..884 859..900 210 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 15:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
shf-RA 1784 CG3135-RA 261..1144 17..900 4364 99.7 Plus
shf-RB 1796 CG3135-RB 261..1156 17..900 4244 98.3 Plus
shf-RD 1745 CG3135-RD 261..1053 17..809 3965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6774561..6774951 407..17 1955 100 Minus
X 23542271 X 6774183..6774444 665..404 1310 100 Minus
X 23542271 X 6773924..6774109 851..666 919 99.5 Minus
X 23542271 X 6773210..6773252 900..858 215 100 Minus
Blast to na_te.dros performed on 2015-02-12 15:53:01 has no hits.

BO08254.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:42:18 Download gff for BO08254.5prime
Subject Subject Range Query Range Percent Splice Strand
shf-PA 1..883 17..899 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:34:35 Download gff for BO08254.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3135-PA 1..883 17..899 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:10:15 Download gff for BO08254.5prime
Subject Subject Range Query Range Percent Splice Strand
shf-RA 261..1143 17..899 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:25:36 Download gff for BO08254.5prime
Subject Subject Range Query Range Percent Splice Strand
shf-RA 261..1143 17..899 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:25:36 Download gff for BO08254.5prime
Subject Subject Range Query Range Percent Splice Strand
X 6774561..6774951 17..407 100   Minus
X 6774183..6774440 408..665 100 <- Minus
X 6773915..6774109 666..860 98 <- Minus
X 6773211..6773249 861..899 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:10:15 Download gff for BO08254.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6668594..6668984 17..407 100   Minus
arm_X 6668216..6668473 408..665 100 <- Minus
arm_X 6667948..6668142 666..860 98 <- Minus
arm_X 6667244..6667282 861..899 100 <- Minus

BO08254.complete Sequence

1402 bp (1402 high quality bases) assembled on 2006-01-10

GenBank Submission: FJ631125

> BO08254.complete
GAAGTTATCAGTCGACATGACACATCAGGGCATCGGCTGCCTGGTCAAGT
GGTTATATCTGGTGCTGATCGTGCACACGCTCCTCTGCATCGGCCAGCTC
GAGTGTCGCCAGCAGCACCACAATCGGAATAACAATAATAATAACAGAAG
AGCGGACTCGTCCAGCTCAGAGGAGGGCCACGGCAACACCAGCGATGGCC
TGGACAACTTCGCAGATCAGGACGCCAGCTTCGTTGGCCATGGACACCAG
CCGCGTCGGGGTCAACGAAAGAAACAGCAGGGAGGTGGAGGAGGAGGCAG
CGGCGGCGGCGGCGGAAACGGAGGAGGCGGTGGAAGCCGGCACAATCGCA
ACGAGGAGAGCGGCATCTCGTTGTGGATCAATGAGCAGCAGCTCAAAATG
CTTACAGCGCTCTACTTCCCACAGGGCTACTCGGAGCGCCTGTACGCCAT
TCACAACAGCCGGGTGACCAATGATCTGAGGGACACGACGCTGTACAACT
TCCTGGTAATCCCATCGGAGGTCAACTACGTTAACTTCACATGGAAGTCG
GGGCGCCGCAAATACTTCTACGACTTTGACCGCCTGCAGACCATGGATGA
AAGTATCTTGAAGGCGCCAACGCTGTCCATTCGCAAGAGCGGACGCATTC
CGCAGGAGCAGAAAAATTTTAGCATATTCCTGCCCTGCACCGGCAACAGC
TCCGGCACCGCGTCCTTCAACGTCGGCCTCAAGATCCAGACGCGCCACAA
CAAGCCGCTCTCGGGCACACCCATTCGCCTCAACTTCAAAAAGGAATGCG
CCCACAGAGGTGTGTATGATATAGACGCTTCCAACCCTACTTCACTAACA
ACTTTGCAAGAATGCAGCTTGAAGTGCGGCAAGAACGGGTACTGCAACGA
GCACCACATCTGCAAGTGCAACGTGGGCTACACGGGCCAATACTGCGAGA
CGGCCTTCTGTTTTCCGCAGTGTCTCAATGGCGGTAACTGCACGGCGCCG
TCCGTCTGCACCTGTCCGGAGGGCTACCAGGGCACGCAGTGCGAAGGTGG
TATTTGCAAGGACAAGTGCTTGAATGGCGGCAAGTGTATACAGAAGGACA
AGTGCCAGTGCTCCAAGGGTTACTACGGCCTGCGTTGCGAGTACTCCAAG
TGTGTGATCCCCTGCAAGAACGAGGGACGGTGCATCGGGAACAACCTGTG
CCGCTGCCCCAACGGACTACGAGGCGATCACTGCGAGATCGGGCGCAAGC
AGCGCTCCATCTGCAAGTGTCGCAATGGCACCTGCGTCTCCCACAAGCAC
TGCAAGTGCCATCCGGGATTCTATGGACGCCACTGCAACGGTCGCAAGCG
ACGACATGTCCACCGAAACGATGACTCCAAGTTCGCAAGCTTTCTAGACC
AT

BO08254.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
shf-RA 1371 CG3135-PA 1..1368 17..1384 6840 100 Plus
shf-RB 1383 CG3135-PB 1..1380 17..1384 6685 99.1 Plus
shf-RD 1332 CG3135-PD 1..793 17..809 3965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
shf-RA 1784 CG3135-RA 261..1628 17..1384 6840 100 Plus
shf-RB 1796 CG3135-RB 261..1640 17..1384 6685 99.1 Plus
shf-RD 1745 CG3135-RD 261..1053 17..809 3965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6774561..6774951 407..17 1955 100 Minus
X 23542271 X 6774183..6774444 665..404 1310 100 Minus
X 23542271 X 6771732..6771934 1348..1146 1000 99.5 Minus
X 23542271 X 6773915..6774109 860..666 975 100 Minus
X 23542271 X 6773058..6773251 1052..859 970 100 Minus
X 23542271 X 6772005..6772101 1145..1049 485 100 Minus
X 23542271 X 6771619..6771659 1384..1344 205 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:03:03 has no hits.

BO08254.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:10:48 Download gff for BO08254.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 1..1371 17..1385 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:31:27 Download gff for BO08254.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 261..1628 17..1384 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:28:31 Download gff for BO08254.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 261..1628 17..1386 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:10:48 Download gff for BO08254.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 261..1628 17..1384 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:09:59 Download gff for BO08254.complete
Subject Subject Range Query Range Percent Splice Strand
shf-RA 261..1628 17..1386 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:09:59 Download gff for BO08254.complete
Subject Subject Range Query Range Percent Splice Strand
X 6774561..6774951 17..407 100   Minus
X 6774183..6774440 408..665 100 <- Minus
X 6773915..6774109 666..860 100 <- Minus
X 6773061..6773249 861..1049 100 <- Minus
X 6772005..6772100 1050..1145 100 <- Minus
X 6771737..6771934 1146..1343 100 <- Minus
X 6771617..6771659 1344..1386 95 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:28:31 Download gff for BO08254.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6668594..6668984 17..407 100   Minus
arm_X 6668216..6668473 408..665 100 <- Minus
arm_X 6667948..6668142 666..860 100 <- Minus
arm_X 6667094..6667282 861..1049 100 <- Minus
arm_X 6666038..6666133 1050..1145 100 <- Minus
arm_X 6665770..6665967 1146..1343 100 <- Minus
arm_X 6665650..6665692 1344..1386 95 <- Minus

BO08254.pep Sequence

Translation from 16 to 1402

> BO08254.pep
MTHQGIGCLVKWLYLVLIVHTLLCIGQLECRQQHHNRNNNNNNRRADSSS
SEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGG
NGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRV
TNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKA
PTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSG
TPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNEHHICK
CNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDK
CLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNG
LRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHR
NDDSKFASFLDH

BO08254.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
shf-PA 456 CG3135-PA 1..456 1..456 2579 100 Plus
shf-PB 460 CG3135-PB 1..460 1..456 2564 99.1 Plus
shf-PD 443 CG3135-PD 1..443 1..456 2469 96.7 Plus
shf-PC 439 CG3135-PC 1..439 1..456 2465 96.3 Plus
NimB2-PA 421 CG31839-PA 215..372 280..435 284 38 Plus