Clone BO08369 Report

Search the DGRC for BO08369

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:83
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG17323-RA
Protein status:BO08369.pep: validated full length
Sequenced Size:1591

Clone Sequence Records

BO08369.3prime Sequence

881 bp (877 high quality bases) assembled on 2006-01-06

> BO08369.3prime
ATGGTCTAGAAAGCTTGCATCCTTCTTAGTCTTCTGGGCGGCACTGGATC
CGCAACAGAGTCGAAGGAGCCACACCCAACTGGCAATGATGCTGCCCAGG
ACGAGGGCCAACACGGCATAGACATCCAGGGAGTAGTAAACGAATCGTGA
CATCTCGACGGCACTGGGCTTCAACAGAGGAGCTCCGCCAGTGTGGGCCA
CATGCTCCACCCACCAAATGGCTGTATGCAGGGCCTGCTGTGGGCGGTGG
TGGAACGAGTGGGAGACTACTTTGGCAGCATCGTGGAACTTTTTGTCCAA
AGCCTTCTTTAGTGCCCTCATCACCGTGTTTTCGCCTATATCCTCGAAAT
TCAGGATAGTTCCCATGCCTCGCTCGACCAAAGCGGCCGTATTGACAAAC
TGATCGCCATACATGGGCGTCGCAACCACTGGGACTCCACAGTAAGCTGC
CTCCGAGGTGCCCATGAGTCCGCCGTGGGACATGAACACCTTGACGTTGG
GATGGCAGAGGATATCGCGTTGTGGCAACCACTTCATAATGTGCATGTTG
GGTGGCTGGTTAGGCAGTGTTTCGTTTTCCCATTTCCAGATAACCTTCTG
CTTTAATCGAGCCACCGCCCGAATAATGCCATCCCTTTTCGCCGCCGACA
GGGAATTCGCCCGGATCATTGATCCCCAACTAATCAGGATCACTCCTTCC
TCAGCATTGTCCAGAATGCGCTGCAGATCGGCAGGCAGAGGCTTCGATTT
CTGGATGTGGATGCCACCCAGCTCGATGACATTGGGCGGCGTTACCTTGG
GTCCAGACAGCGAGTAGTGCTGGTTCACAAAGAACATGGATGTGTTCTTC
ACCAGCTCGCCCACCGAAGGCACGTCATGGC

BO08369.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-PA 1560 CG17323-RA 695..1557 881..19 4315 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 16:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-RD 2212 CG17323-RD 834..1696 881..19 4315 100 Minus
CG17323-RC 1988 CG17323-RC 773..1635 881..19 4315 100 Minus
CG17323-RE 2112 CG17323-RE 897..1759 881..19 4315 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18825281..18825874 881..288 2970 100 Minus
2L 23513712 2L 18825930..18826200 289..19 1355 100 Minus
2L 23513712 2L 18828272..18828425 602..449 245 77.3 Minus
Blast to na_te.dros performed on 2015-02-11 16:41:50 has no hits.

BO08369.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:45:22 Download gff for BO08369.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-PA 695..1560 18..881 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:39:13 Download gff for BO08369.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-PA 695..1560 18..881 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 12:44:50 Download gff for BO08369.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 897..1764 12..881 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:18:08 Download gff for BO08369.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 897..1764 12..881 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:18:08 Download gff for BO08369.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18825930..18826205 12..289 98   Minus
2L 18825281..18825872 290..881 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 12:44:50 Download gff for BO08369.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18825930..18826205 12..289 98   Minus
arm_2L 18825281..18825872 290..881 100 -> Minus

BO08369.5prime Sequence

958 bp (838 high quality bases) assembled on 2006-01-06

> BO08369.5prime
GAAGTTATCAGTCGACATGTGGTCGCCGCGGGTTGCCCTACTTTTCCTGG
CCCTAGCACTTAGCCAACCGGACGAGTTGGTGGAGGCCGCTGGTCCGCTG
AAGGTGCTGGGTCTTTTTCCCCATCCCGGAGTTAGCCACTTCCACTTCTT
CCACCCCATCATGAAGGGTCTGGCCGAGGCGGGTCATGACGTGAGCGTGG
TTTCCCACTTCCCGGACAAGCATCCGGTTGCCCACTACAAGGATTTCCCC
CTCACCGGAATGGACAAGCTCACGAACAGTGTTGATCTCAAGTTTTTCGA
GAAGCGCACATTCTACAGTCACTTCCAGGAGTTCTTCCTGCTGTACGACT
GGGGCAAACAGACATGCAACCTGACGCTCCGTTCGGAAGCACTGCAGCAG
ATCCTCAGGCGTCCGGGACGCTTTGATGTGATCATCATGGAGCAATTCAA
CACTGACTGCATGATGGGAGTGGCCCACCAGCTCCAGGCGCCGGTGATCG
CCTTGAGCAGCTGTGTGATGATGCCCTGGCACTACGAGCGAATGGGAGCT
CCTTTGATACCCTCTCACATCCCGGCGCTCTTCATGGCCCAGTCGCAGCA
CATGAACTTTGGGGGACGACTGGCCAATTGGTTCAGCACCCACGCCTTAA
ATTGGATGTACAAATTACTATCGGTTCCCGCTGCCGACGCCATGGTTCAG
TACAAATTCGGCCATGACGTGCCTTCGGTGGGCGAGCTGGTGAAGAACAC
ATCCATGTTCTTTGTGAACCAGCACTACTCGCTGTCTGGACCCAAGGTAA
CGCCGCCCAATGTCATCGAGCTGGGTGGCATCCACATCCAGAAATCGAAG
CCTCTGCCTGCCGATCTGCAGCGCATTCTGGACAATGCTGAGGAAGGAGT
GATCCCTGATAGTTGGGGATCAATGATCCCGGCCGAATCCCTGTCGGCGG
CGAAAAGG

BO08369.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-PA 1560 CG17323-RA 1..889 17..905 4445 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-RD 2212 CG17323-RD 140..1081 17..958 4605 99.5 Plus
CG17323-RC 1988 CG17323-RC 79..1020 17..958 4605 99.5 Plus
CG17323-RE 2112 CG17323-RE 203..1144 17..958 4605 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18824795..18825167 291..663 1865 100 Plus
2L 23513712 2L 18824306..18824581 17..292 1380 100 Plus
2L 23513712 2L 18825234..18825528 664..958 1355 97.3 Plus
Blast to na_te.dros performed on 2015-02-12 00:36:26 has no hits.

BO08369.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:45:23 Download gff for BO08369.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-PA 1..942 17..958 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:39:14 Download gff for BO08369.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-PA 1..942 17..958 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 20:00:59 Download gff for BO08369.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 203..1144 17..958 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:01:01 Download gff for BO08369.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 203..1144 17..958 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:01:01 Download gff for BO08369.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18825234..18825528 664..958 98   Plus
2L 18824797..18825167 293..663 100 -> Plus
2L 18824306..18824581 17..292 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 20:00:59 Download gff for BO08369.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18825234..18825528 664..958 98   Plus
arm_2L 18824797..18825167 293..663 100 -> Plus
arm_2L 18824306..18824581 17..292 100 -> Plus

BO08369.complete Sequence

1591 bp (1591 high quality bases) assembled on 2006-01-10

GenBank Submission: FJ631167

> BO08369.complete
GAAGTTATCAGTCGACATGTGGTCGCCGCGGGTTGCCCTACTTTTCCTGG
CCCTAGCACTTAGCCAACCGGACGAGTTGGTGGAGGCCGCTGGTCCGCTG
AAGGTGCTGGGTCTTTTTCCCCATCCCGGAGTTAGCCACTTCCACTTCTT
CCACCCCATCATGAAGGGTCTGGCCGAGGCGGGTCATGACGTGAGCGTGG
TTTCCCACTTCCCGGACAAGCATCCGGTTGCCCACTACAAGGATTTCCCC
CTCACCGGAATGGACAAGCTCACGAACAGTGTTGATCTCAAGTTTTTCGA
GAAGCGCACATTCTACAGTCACTTCCAGGAGTTCTTCCTGCTGTACGACT
GGGGCAAACAGACATGCAACCTGACGCTCCGTTCGGAAGCACTGCAGCAG
ATCCTCAGGCGTCCGGGACGCTTTGATGTGATCATCATGGAGCAATTCAA
CACTGACTGCATGATGGGAGTGGCCCACCAGCTCCAGGCGCCGGTGATCG
CCTTGAGCAGCTGTGTGATGATGCCCTGGCACTACGAGCGAATGGGAGCT
CCTTTGATACCCTCTCACATCCCGGCGCTCTTCATGGCCCAGTCGCAGCA
CATGAACTTTGGGGGACGACTGGCCAATTGGTTCAGCACCCACGCCTTAA
ATTGGATGTACAAATTACTATCGGTTCCCGCTGCCGACGCCATGGTTCAG
TACAAATTCGGCCATGACGTGCCTTCGGTGGGCGAGCTGGTGAAGAACAC
ATCCATGTTCTTTGTGAACCAGCACTACTCGCTGTCTGGACCCAAGGTAA
CGCCGCCCAATGTCATCGAGCTGGGTGGCATCCACATCCAGAAATCGAAG
CCTCTGCCTGCCGATCTGCAGCGCATTCTGGACAATGCTGAGGAAGGAGT
GATCCTGATTAGTTGGGGATCAATGATCCGGGCGAATTCCCTGTCGGCGG
CGAAAAGGGATGGCATTATTCGGGCGGTGGCTCGATTAAAGCAGAAGGTT
ATCTGGAAATGGGAAAACGAAACACTGCCTAACCAGCCACCCAACATGCA
CATTATGAAGTGGTTGCCACAACGCGATATCCTCTGCCATCCCAACGTCA
AGGTGTTCATGTCCCACGGCGGACTCATGGGCACCTCGGAGGCAGCTTAC
TGTGGAGTCCCAGTGGTTGCGACGCCCATGTATGGCGATCAGTTTGTCAA
TACGGCCGCTTTGGTCGAGCGAGGCATGGGAACTATCCTGAATTTCGAGG
ATATAGGCGAAAACACGGTGATGAGGGCACTAAAGAAGGCTTTGGACAAA
AAGTTCCACGATGCTGCCAAAGTAGTCTCCCACTCGTTCCACCACCGCCC
ACAGCAGGCCCTGCATACAGCCATTTGGTGGGTGGAGCATGTGGCCCACA
CTGGCGGAGCTCCTCTGTTGAAGCCCAGTGCCGTCGAGATGTCACGATTC
GTTTACTACTCCCTGGATGTCTATGCCGTGTTGGCCCTCGTCCTGGGCAG
CATCATTGCCAGTTGGGTGTGGCTCCTTCGACTCTGTTGCGGATCCAGTG
CCGCCCAGAAGACTAAGAAGGATGCAAGCTTTCTAGACCAT

BO08369.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-RD 1560 CG17323-PD 1..1557 17..1573 7785 100 Plus
CG17323-RC 1560 CG17323-PC 1..1557 17..1573 7785 100 Plus
CG17323-RE 1560 CG17323-PE 1..1557 17..1573 7785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-RD 2212 CG17323-RD 140..1696 17..1573 7785 100 Plus
CG17323-RC 1988 CG17323-RC 79..1635 17..1573 7785 100 Plus
CG17323-RE 2112 CG17323-RE 203..1759 17..1573 7785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18825234..18825874 664..1304 3205 100 Plus
2L 23513712 2L 18824795..18825167 291..663 1865 100 Plus
2L 23513712 2L 18824306..18824581 17..292 1380 100 Plus
2L 23513712 2L 18825930..18826200 1303..1573 1355 100 Plus
2L 23513712 2L 18828272..18828425 990..1143 245 77.3 Plus
Blast to na_te.dros performed on 2014-11-26 16:19:21 has no hits.

BO08369.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:10:11 Download gff for BO08369.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 1..1560 17..1574 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:30:30 Download gff for BO08369.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 31..1592 17..1580 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:57:53 Download gff for BO08369.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 203..1759 17..1575 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:10:11 Download gff for BO08369.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RA 31..1592 17..1580 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:16:22 Download gff for BO08369.complete
Subject Subject Range Query Range Percent Splice Strand
CG17323-RE 203..1759 17..1575 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:16:22 Download gff for BO08369.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18825930..18826200 1303..1575 99   Plus
2L 18825234..18825872 664..1302 100 -> Plus
2L 18824797..18825167 293..663 100 -> Plus
2L 18824306..18824581 17..292 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:57:53 Download gff for BO08369.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18825930..18826200 1303..1575 99   Plus
arm_2L 18825234..18825872 664..1302 100 -> Plus
arm_2L 18824797..18825167 293..663 100 -> Plus
arm_2L 18824306..18824581 17..292 100 -> Plus

BO08369.pep Sequence

Translation from 16 to 1591

> BO08369.pep
MWSPRVALLFLALALSQPDELVEAAGPLKVLGLFPHPGVSHFHFFHPIMK
GLAEAGHDVSVVSHFPDKHPVAHYKDFPLTGMDKLTNSVDLKFFEKRTFY
SHFQEFFLLYDWGKQTCNLTLRSEALQQILRRPGRFDVIIMEQFNTDCMM
GVAHQLQAPVIALSSCVMMPWHYERMGAPLIPSHIPALFMAQSQHMNFGG
RLANWFSTHALNWMYKLLSVPAADAMVQYKFGHDVPSVGELVKNTSMFFV
NQHYSLSGPKVTPPNVIELGGIHIQKSKPLPADLQRILDNAEEGVILISW
GSMIRANSLSAAKRDGIIRAVARLKQKVIWKWENETLPNQPPNMHIMKWL
PQRDILCHPNVKVFMSHGGLMGTSEAAYCGVPVVATPMYGDQFVNTAALV
ERGMGTILNFEDIGENTVMRALKKALDKKFHDAAKVVSHSFHHRPQQALH
TAIWWVEHVAHTGGAPLLKPSAVEMSRFVYYSLDVYAVLALVLGSIIASW
VWLLRLCCGSSAAQKTKKDASFLDH

BO08369.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG17323-PD 519 CG17323-PD 1..519 1..519 2768 100 Plus
CG17323-PC 519 CG17323-PC 1..519 1..519 2768 100 Plus
CG17323-PE 519 CG17323-PE 1..519 1..519 2768 100 Plus
CG17323-PA 519 CG17323-PA 1..519 1..519 2768 100 Plus
CG17322-PB 517 CG17322-PB 7..502 9..506 1570 59.8 Plus