Clone BO08539 Report

Search the DGRC for BO08539

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:85
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptUbcD4-RA
Protein status:BO08539.pep: validated full length
Sequenced Size:631

Clone Sequence Records

BO08539.3prime Sequence

629 bp (628 high quality bases) assembled on 2006-01-06

> BO08539.3prime
ATGGTCTAGAAAGCTTGCACTGAACAGGCCCTCGGTGGCCTTCTCCAAAT
TCCAATTCTCCTTGGAGAGCACGGCGCGCGCCTCATGCTCGTCGATGCCC
ATGTCCCTGAGACGTTGGATCTTTGAATCACAATCGGGAAAGGTGTGCGG
TCCGCCCGCATACGCGTTGGTCCAGTGCTTGGCCGTAAGCAGGAACAGAT
CGTACTTGTCCTTAAACTGATAGGCCACCACTGCGTCCTGTGGATCGTCC
GGCTCTGCGGCGGCCAGGAGCGCCTGCAGCGACAGCAGTACGGTGCGCAG
TGTCATCGCTGCAGCCCAGTTGTCCTTTAAGATGTCCAAGCAAATCGCAC
CCGTAACCGACGATATATTCGGATGCCAGATGCGCGTTATGAAGCGTACC
TTTGGTGGATTGAAGGGATATGTCTCGGGCACCTTGATCTCCAGGACGAA
CTTGCCGCCCTCGTAGGGCGTGTCAGGCGGACCGGCGATCTCGCCGCGCA
GCTCCGTCCAACTGTCATTGACCAGTTCGATTTTGATGGAACACTGGACG
ATCTCCTCGCTGCGCATCACCTCCTTGAACTCCCGCTTGATCCGCGACAC
TGCCATGTTCGCCATGTCGACTGATAACT

BO08539.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG8284-PA 600 UbcD4-RA 1..597 615..19 2985 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-RC 1709 CG8284-RC 357..954 616..19 2990 100 Minus
Ubc4-RB 1473 CG8284-RB 357..954 616..19 2990 100 Minus
Ubc4-RA 1107 CG8284-RA 357..954 616..19 2990 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 18:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9699344..9699726 401..19 1915 100 Minus
3L 28110227 3L 9698964..9699123 554..395 800 100 Minus
3L 28110227 3L 9698692..9698755 616..553 320 100 Minus
Blast to na_te.dros performed on 2015-02-11 18:10:34 has no hits.

BO08539.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:49:54 Download gff for BO08539.3prime
Subject Subject Range Query Range Percent Splice Strand
UbcD4-PA 1..600 18..615 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:45:43 Download gff for BO08539.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8284-PA 1..600 18..615 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 12:34:23 Download gff for BO08539.3prime
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 354..960 11..623 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:36:18 Download gff for BO08539.3prime
Subject Subject Range Query Range Percent Splice Strand
Ubc4-RA 354..960 11..623 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:36:18 Download gff for BO08539.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 9699346..9699732 11..399 99   Minus
3L 9698966..9699118 400..552 100 -> Minus
3L 9698689..9698755 553..623 94 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 12:34:23 Download gff for BO08539.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9692446..9692832 11..399 99   Minus
arm_3L 9692066..9692218 400..552 100 -> Minus
arm_3L 9691789..9691855 553..623 94 -> Minus

BO08539.5prime Sequence

629 bp (628 high quality bases) assembled on 2006-01-06

> BO08539.5prime
GAAGTTATCAGTCGACATGGCGAACATGGCAGTGTCGCGGATCAAGCGGG
AGTTCAAGGAGGTGATGCGCAGCGAGGAGATCGTCCAGTGTTCCATCAAA
ATCGAACTGGTCAATGACAGTTGGACGGAGCTGCGCGGCGAGATCGCCGG
TCCGCCTGACACGCCCTACGAGGGCGGCAAGTTCGTCCTGGAGATCAAGG
TGCCCGAGACATATCCCTTCAATCCACCAAAGGTACGCTTCATAACGCGC
ATCTGGCATCCGAATATATCGTCGGTTACGGGTGCGATTTGCTTGGACAT
CTTAAAGGACAACTGGGCTGCAGCGATGACACTGCGCACCGTACTGCTGT
CGCTGCAGGCGCTCCTGGCCGCCGCAGAGCCGGACGATCCACAGGACGCA
GTGGTGGCCTATCAGTTTAAGGACAAGTACGATCTGTTCCTGCTTACGGC
CAAGCACTGGACCAACGCGTATGCGGGCGGACCGCACACCTTTCCCGATT
GTGATTCAAAGATCCAACGTCTCAGGGACATGGGCATCGACGAGCATGAG
GCGCGCGCCGTGCTCTCCAAGGAGAATTGGAATTTGGAGAAGGCCACCGA
GGGCCTGTTCAGTGCAAGCTTTCTAGACC

BO08539.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 13:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG8284-PA 600 UbcD4-RA 1..597 17..613 2985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-RC 1709 CG8284-RC 357..954 16..613 2990 100 Plus
Ubc4-RB 1473 CG8284-RB 357..954 16..613 2990 100 Plus
Ubc4-RA 1107 CG8284-RA 357..954 16..613 2990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9699344..9699726 231..613 1915 100 Plus
3L 28110227 3L 9698964..9699123 78..237 800 100 Plus
3L 28110227 3L 9698692..9698755 16..79 320 100 Plus
Blast to na_te.dros performed on 2015-02-11 23:37:47 has no hits.

BO08539.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 03:49:55 Download gff for BO08539.5prime
Subject Subject Range Query Range Percent Splice Strand
UbcD4-PA 1..600 17..614 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:45:45 Download gff for BO08539.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8284-PA 1..600 17..614 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 19:54:58 Download gff for BO08539.5prime
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 354..960 9..621 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:52:28 Download gff for BO08539.5prime
Subject Subject Range Query Range Percent Splice Strand
Ubc4-RA 354..960 9..621 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:52:28 Download gff for BO08539.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 9699346..9699732 233..621 99   Plus
3L 9698966..9699118 80..232 100 -> Plus
3L 9698689..9698755 9..79 94 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 19:54:58 Download gff for BO08539.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9692446..9692832 233..621 99   Plus
arm_3L 9692066..9692218 80..232 100 -> Plus
arm_3L 9691789..9691855 9..79 94 -> Plus

BO08539.complete Sequence

631 bp (631 high quality bases) assembled on 2005-12-21

GenBank Submission: FJ631230

> BO08539.complete
GAAGTTATCAGTCGACATGGCGAACATGGCAGTGTCGCGGATCAAGCGGG
AGTTCAAGGAGGTGATGCGCAGCGAGGAGATCGTCCAGTGTTCCATCAAA
ATCGAACTGGTCAATGACAGTTGGACGGAGCTGCGCGGCGAGATCGCCGG
TCCGCCTGACACGCCCTACGAGGGCGGCAAGTTCGTCCTGGAGATCAAGG
TGCCCGAGACATATCCCTTCAATCCACCAAAGGTACGCTTCATAACGCGC
ATCTGGCATCCGAATATATCGTCGGTTACGGGTGCGATTTGCTTGGACAT
CTTAAAGGACAACTGGGCTGCAGCGATGACACTGCGCACCGTACTGCTGT
CGCTGCAGGCGCTCCTGGCCGCCGCAGAGCCGGACGATCCACAGGACGCA
GTGGTGGCCTATCAGTTTAAGGACAAGTACGATCTGTTCCTGCTTACGGC
CAAGCACTGGACCAACGCGTATGCGGGCGGACCGCACACCTTTCCCGATT
GTGATTCAAAGATCCAACGTCTCAGGGACATGGGCATCGACGAGCATGAG
GCGCGCGCCGTGCTCTCCAAGGAGAATTGGAATTTGGAGAAGGCCACCGA
GGGCCTGTTCAGTGCAAGCTTTCTAGACCAT

BO08539.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-RC 600 CG8284-PC 1..597 17..613 2985 100 Plus
Ubc4-RB 600 CG8284-PB 1..597 17..613 2985 100 Plus
Ubc4-RA 600 CG8284-PA 1..597 17..613 2985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-RC 1709 CG8284-RC 357..954 16..613 2990 100 Plus
Ubc4-RB 1473 CG8284-RB 357..954 16..613 2990 100 Plus
Ubc4-RA 1107 CG8284-RA 357..954 16..613 2990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9699344..9699726 231..613 1915 100 Plus
3L 28110227 3L 9698964..9699123 78..237 800 100 Plus
3L 28110227 3L 9698692..9698755 16..79 320 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:39:31 has no hits.

BO08539.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:55:23 Download gff for BO08539.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 1..600 17..614 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:27:46 Download gff for BO08539.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 348..954 9..621 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:28:58 Download gff for BO08539.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 358..954 17..615 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:55:23 Download gff for BO08539.complete
Subject Subject Range Query Range Percent Splice Strand
UbcD4-RA 348..954 9..621 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:35:47 Download gff for BO08539.complete
Subject Subject Range Query Range Percent Splice Strand
Ubc4-RA 358..954 17..615 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:35:47 Download gff for BO08539.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9699346..9699726 233..615 99   Plus
3L 9698966..9699118 80..232 100 -> Plus
3L 9698693..9698755 17..79 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:28:58 Download gff for BO08539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9692446..9692826 233..615 99   Plus
arm_3L 9692066..9692218 80..232 100 -> Plus
arm_3L 9691793..9691855 17..79 100 -> Plus

BO08539.pep Sequence

Translation from 16 to 631

> BO08539.pep
MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTP
YEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNW
AAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTN
AYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATEGLFSA
SFLDH

BO08539.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Ubc4-PC 199 CG8284-PC 1..199 1..199 1049 100 Plus
Ubc4-PB 199 CG8284-PB 1..199 1..199 1049 100 Plus
Ubc4-PA 199 CG8284-PA 1..199 1..199 1049 100 Plus
eff-PC 147 CG7425-PC 1..146 4..153 308 44.7 Plus
eff-PB 147 CG7425-PB 1..146 4..153 308 44.7 Plus